KEGG   Aeropyrum pernix: APE_0171.1Help
Entry
APE_0171.1        CDS       T00023                                 

Definition
(GenBank) glyceraldehyde 3-phosphate dehydrogenase
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
ape  Aeropyrum pernix
Pathway
ape00010  Glycolysis / Gluconeogenesis
ape01100  Metabolic pathways
ape01110  Biosynthesis of secondary metabolites
ape01120  Microbial metabolism in diverse environments
ape01130  Biosynthesis of antibiotics
ape01200  Carbon metabolism
ape01230  Biosynthesis of amino acids
Module
ape_M00002  Glycolysis, core module involving three-carbon compounds
ape_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ape00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APE_0171.1
Enzymes [BR:ape01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     APE_0171.1
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N 2-Hacid_dh_C GFO_IDH_MocA Sacchrp_dh_NADP NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: BAA79082
UniProt: Q9YFS9
Position
complement(127388..128419)
Genome map
AA seq 343 aa AA seqDB search
MSVVKVGVNGFGTIGRRVALAITLQKDMKLVGVVKRTPDYAALYAASRGIPIYTPTAKEA
EEFEKRGIKVGGTLRELLARVDVVVDATPEGQGAKNKPLYREAGVKQVYQGGEKPEVAEA
SFSTLCNYEESKGRGSLRVVSCNTTGLLRLICTLNREFGVESVRAVLVRRGADPKEVKKG
PIDSIVLNPPTLPSHHAVDVRTVLPWLDIKTAAVAVPTTFMHMHHVTLKLAKPVEKREVL
ETLASAPRIMLVSSGDTGIKSTSQLVDAARLSRMGYDIPELVVFEESVAVDGREVMLFQA
VHQESIVVPENIDAIRAVASSPLTLDETLKATDGSLGLRKTLW
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtagttaaagtcggtgtgaacggtttcggcactataggcaggagggtggccctc
gcaataacacttcaaaaggacatgaagcttgtgggcgttgttaagaggaccccggactat
gccgccctctacgccgcgtccagggggataccgatttacacacctactgctaaggaagca
gaggagtttgagaaacgcggcataaaggtgggaggcaccctcagagagctcctcgcccgg
gttgacgttgtcgtcgacgccacgccggagggccagggagcgaagaacaagcccctctac
agggaggcgggtgttaagcaggtataccagggcggggagaagcctgaggttgccgaggcc
agcttcagcaccctctgcaactacgaggagagcaagggaagggggagccttcgggtcgtg
tcatgcaataccaccggccttctaaggcttatatgcaccctgaacagggagttcggggtc
gagagtgtcagggccgttctcgtgaggaggggagcagatcctaaggaggttaagaagggg
cctatagactctattgttcttaacccaccgaccctccccagccaccacgctgtagacgta
agaacagtgctaccctggcttgacataaaaactgccgccgtagcagtgccaacaacgttc
atgcatatgcaccacgttaccctgaaattggcaaagcctgttgaaaagagggaggtgctt
gaaaccctggcatccgccccccgtataatgctagttagcagtggtgacactggtataaag
tcgacgtcgcagctcgtagacgcagctaggttatcgaggatgggctatgatatacccgag
ctcgtagtgtttgaggagagcgttgctgtggatgggagggaagttatgttgttccaggcg
gtacaccaggagtctatcgtcgtgccggaaaatatagatgccataagggctgttgcctcg
tcccctctaaccctggacgaaaccttgaaggccactgacgggagcctgggcctcaggaaa
accctgtggtag

DBGET integrated database retrieval system