KEGG   Aeropyrum pernix: APE_0662.1
Entry
APE_0662.1        CDS       T00023                                 

Gene name
hisS
Definition
(GenBank) histidyl-tRNA synthetase
  KO
K01892  histidyl-tRNA synthetase [EC:6.1.1.21]
Organism
ape  Aeropyrum pernix
Pathway
ape00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ape00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    APE_0662.1 (hisS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ape01007]
    APE_0662.1 (hisS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ape03016]
    APE_0662.1 (hisS)
Enzymes [BR:ape01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.21  histidine---tRNA ligase
     APE_0662.1 (hisS)
Amino acid related enzymes [BR:ape01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   APE_0662.1 (hisS)
Transfer RNA biogenesis [BR:ape03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    APE_0662.1 (hisS)
 Prokaryotic type
    APE_0662.1 (hisS)
SSDB
Motif
Pfam: tRNA-synt_His HGTP_anticodon tRNA-synt_2b EAD4 tRNA-synt_2d tRNA-synt_2 PPR Nuc_sug_transp
Other DBs
NCBI-ProteinID: BAA79634
UniProt: Q9YEB2
Position
442462..443769
AA seq 435 aa
MAGGRPRPPRGFRDFPPEVMILRKRLLSRLERVFESYGFDPLDTPAVEYWETLSGKYGEE
AESRLIWRFQDPWSGRWYALRYDLTVPLARFVASNPGLPMPFKRYHIGKVWRHEEPQKGR
YREFVQCDADIVGSPYPEADAEIVSLAVDSIDALGLPGFRVRVNDRRLLAGVFEEELGFD
NPLPIYRAIDKLDKIGVEGVRRELERLGLPGSTVERIMEIISWRGRPGEVLESVRRGYGS
NEKVREALDHLEEMLSLADDKRVELDMSLVRGLDYYTGPILEVVLDEPRIGSVAGGGRYD
GLVGMFAGRDIPATGVSIGIERIIDAGLELGVYSLDVKTVAQVAVVVLDRRYYRYAWEAA
RILRRGGLNVRIDLSRASGQVQRRKASRLGIPVLAFVGAKEAEGGFLTLYSAAKGERVAV
PLGEAVKAVERLLPS
NT seq 1308 nt   +upstreamnt  +downstreamnt
gtggcaggaggtcgccctagacccccccgggggttcagggactttccacccgaagtcatg
atactcaggaagaggctcctctccaggctcgagagagttttcgagagctacggcttcgac
ccgctggacacgccggcggtggagtattgggagaccctctccggtaagtatggtgaggag
gcggagtcgaggctgatatggaggttccaggacccgtggagcgggaggtggtacgcgcta
aggtacgacctcactgtccccctagccaggttcgtggcctcaaacccggggctgccgatg
cctttcaagaggtaccacatagggaaggtttggaggcacgaggagccgcagaaggggagg
tacagggagttcgtccagtgcgacgcagacatagtcggcagcccctacccggaggcggac
gcggagattgtaagccttgctgtggacagtatcgacgccctggggctcccagggtttagg
gttagggttaacgataggcgcctcctcgccggggttttcgaggaggagctggggtttgac
aaccccctccccatctacagggctatagacaagctggataagataggtgtggagggtgtt
aggagggagctagagaggctggggctcccgggatccaccgttgaaaggatcatggagatt
atctcctggagggggaggcccggcgaggtcctggagtccgtcaggaggggttacggctcc
aacgagaaggttagggaggcgcttgaccatctagaggagatgctctccctcgccgacgat
aagagggtagagcttgacatgagcctcgttaggggcctcgactactacaccggccctata
ctcgaggtagtcctagacgagccgaggataggtagtgtagcggggggagggaggtacgac
gggcttgtggggatgttcgcggggagggatataccggccactggcgtgagcataggaata
gagaggatcatagacgctggcctcgagctcggggtttacagtctagacgtgaagacagta
gcccaggttgccgtcgtcgtgctagaccggaggtactacaggtacgcctgggaggcggcc
cgcatactcaggaggggtgggctaaacgttaggatagacctctcccgggccagcggccag
gttcagaggaggaaggcctcgaggctgggcatacccgtcttggctttcgtgggggccaag
gaggctgagggcgggttcctaacgctctacagcgccgcgaagggtgagagggttgcagtg
ccgctgggggaggctgtgaaggcggtggagaggctcctcccctcctaa

DBGET integrated database retrieval system