KEGG   Aeropyrum pernix: APE_0763.1
Entry
APE_0763.1        CDS       T00023                                 

Definition
(GenBank) hypothetical protein
Organism
ape  Aeropyrum pernix
SSDB
Motif
Pfam: Epimerase NAD_binding_4 3Beta_HSD
Other DBs
NCBI-ProteinID: BAA79741
UniProt: Q9YE06
Position
503669..504637
AA seq 322 aa
MARIVVVGGLGYVGVNIAPALADLGELVVVYRGVVGGFRRVIASRLESLGARLVRIDAPM
TADELERLGGDVYIHLAGKISGGYRVQWESHVGLLEAIVEAAGRIGSRVVYTSSVLAYGR
LEDLPPGSLVYEEDEHLSGRRWWRSYHARTKAEGERLLVSSSRRLGGRFSIVRPGLVVGS
HAYHREWSMLFRLSRLGLYPRLDYTVNYVSSKALREVYRRAVTGGLDGKWVHAVSYHAPY
REAAMLVCTRLRGGLCRGLPVKPLFSLAGRLAPPSTALSASWEGVSNGYIFKSRYGVPVD
GSLEEAFSELLEWLAGGGPSAS
NT seq 969 nt   +upstreamnt  +downstreamnt
ttggctaggatagttgtcgttggcggtttaggctatgtgggcgtcaatatagcccctgcg
ttggcggatctgggcgagctggttgttgtgtataggggtgtagtgggggggtttaggcgt
gttatagcgtcgaggctagagtccctgggcgccaggcttgtcaggatagacgcccccatg
acggctgatgagctggagcggcttgggggcgatgtttacatacatctggctggcaagatc
tccggggggtatagggtccagtgggagtcccatgtcggcctcctcgaggctatagtggag
gctgccgggcgcatcggctccagagttgtgtatacgagcagtgtactggcctacggtagg
ctcgaggacctcccgcccgggtctctggtctatgaggaggacgagcacctatctggcagg
cgctggtggaggtcctaccacgccaggacgaaggcggagggggagaggctgctagtctcc
agctcgcggaggcttggagggaggttctccatagtcaggcctggccttgtggtgggttcc
cacgcctatcatagggagtggagcatgctcttcaggctctcgagactcggcctataccca
cgcctcgactacaccgtcaactacgtctcctccaaggccctgagggaggtttataggagg
gctgtcacaggcggtctagacgggaagtgggttcacgcagtttcctaccacgccccctac
cgagaggcggccatgctggtatgcacccgcctgaggggcggtttgtgtagggggctcccg
gtcaaacccctgttctccctggctggcaggcttgcgccaccatctacagccctatcggcc
tcgtgggagggcgtcagcaacggctacatattcaagtcgagatacggcgtccccgtcgac
gggagcctcgaggaggctttcagcgagcttctagagtggctagcaggcgggggcccgagc
gcctcctag

DBGET integrated database retrieval system