KEGG   Aeropyrum pernix: APE_0782.1
Entry
APE_0782.1        CDS       T00023                                 

Gene name
trm1
Definition
(GenBank) N(2),N(2)-dimethylguanosine tRNA methyltransferase
  KO
K00555  tRNA (guanine26-N2/guanine27-N2)-dimethyltransferase [EC:2.1.1.215 2.1.1.216]
Organism
ape  Aeropyrum pernix
Brite
KEGG Orthology (KO) [BR:ape00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ape03016]
    APE_0782.1 (trm1)
Enzymes [BR:ape01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.215  tRNA (guanine26-N2/guanine27-N2)-dimethyltransferase
     APE_0782.1 (trm1)
    2.1.1.216  tRNA (guanine26-N2)-dimethyltransferase
     APE_0782.1 (trm1)
Transfer RNA biogenesis [BR:ape03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    APE_0782.1 (trm1)
SSDB
Motif
Pfam: TRM DUF2067 MTS Met_10 DUF5913
Other DBs
NCBI-ProteinID: BAA79760
UniProt: Q9YDY7
Position
515091..516314
AA seq 407 aa
MPVPSPMRLAVTHEGRSIIYIPSPEYAVASGRLEPAWLEVFYNPAMEFNRDVSVVAASAL
RRTGLLTRSGVAFDAHAGVGVRGVRYAVEAGYVKVIMNDINPKASMLAALNARANGLEPG
SYMIFNKESNSLMFHLSRERPTPVSLIDIDPYGSPAPFVDAALALSGKGTVVAMTATDLA
VLEGGKARAAVRRYMLRSVSKTPVSKETGLRVLLGYVARVAAAHDKAVKPLLAYYADHYY
RVYVAVERGARRSDSMLEENLGRLVYCPETGVALALSYAEDPASACGGSYVVAADPAWIG
SLGDQAFLEAMLNIAVEAVWLGTRPRVEKLLNTLHGEAPLSPRSIYVSLTSVASKARVNT
PKKSKVVELLRSMGYRAVATHFSGEGVRTDAPWGEVLEAVVKLGSSG
NT seq 1224 nt   +upstreamnt  +downstreamnt
ttgccagtgccctctccaatgaggcttgcggtaactcatgagggtaggagtataatctac
atacccagcccagagtacgctgtagcctctggtaggctagagcccgcgtggctggaggtc
ttctacaaccccgccatggagtttaacagggatgtaagcgtagtcgccgcatccgccctg
aggaggacgggtttgctgacgaggtctggcgtagcgttcgacgcccacgcgggggtcggt
gtgaggggcgtgaggtatgctgttgaggcgggttacgtgaaggtgataatgaacgatata
aaccctaaggcttcaatgctggcagcgctcaacgccagagcgaacggtctagagccgggc
tcctacatgatattcaacaaggagtccaacagcctgatgttccacctttccagggagagg
cccacgcctgtttcccttatagatatagacccctacggctcgcccgcgcccttcgtagac
gctgctctcgccctctctggtaaggggaccgtggtcgccatgaccgctaccgatcttgcc
gtgctcgagggagggaaggctagggcggcggtgaggaggtacatgctgaggagcgtctca
aaaactcccgtctccaaggagaccgggttgagggtgctcctggggtatgtggctagggtt
gctgcagcgcacgacaaggctgtgaagccgctgctggcatactatgcggaccattattac
agggtgtatgtggcggtggagcggggggctaggcggtccgactccatgctggaggagaac
cttggcaggctagtctactgccccgagaccggcgtggcgctagccctctcttacgccgag
gaccccgctagcgcgtgtggcggatcctatgtggtggcagcagatcctgcttggatagga
agcctgggagaccaggctttccttgaggctatgcttaacatagcggttgaggcggtatgg
ttgggcacccgcccgagggtggaaaagcttctgaacactctgcatggtgaggcccccctc
tccccgaggagcatatatgtgtcgctgaccagcgtagcatcaaaggccagagtgaacact
cctaagaagagcaaggtcgtggaattgctgaggagtatggggtatagggctgtggcgaca
cacttttcgggtgagggcgtcaggactgacgcgccttggggtgaggtgctggaggctgtt
gtgaaactaggctctagcggatag

DBGET integrated database retrieval system