KEGG   Aeropyrum pernix: APE_0807.1Help
Entry
APE_0807.1        CDS       T00023                                 

Definition
(GenBank) delta-1-pyrroline-5-carboxylate dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
ape  Aeropyrum pernix
Pathway
ape00250  Alanine, aspartate and glutamate metabolism
ape00330  Arginine and proline metabolism
ape01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ape00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    APE_0807.1
   00330 Arginine and proline metabolism
    APE_0807.1
Enzymes [BR:ape01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     APE_0807.1
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Adeno_E1B_55K
Motif
Other DBs
NCBI-ProteinID: BAA79785
UniProt: Q9YDW2
Position
535148..536770
Genome map
AA seq 540 aa AA seqDB search
MALWRIEKPKNEPFLEFRPGTKERELLKKKLEEVKSKTVEIPLIIGGKEVKTGETVEIRA
PHDKDAVLAVAHLAGEEEIRDAIEKALDAWTKWSEMEWYHRASVFLKAADLLAGPYRLEA
DAVIMLNHSKTPWEAEIDLAELVDFWRFGAYYARFIFEQQPEQAPGELNRVEWRPLEGFV
FAVPPFNFFSIGGNLPTAPALVGNVSIWKPSRWVIYSNYIIMRILMEAGLPPGVVNFVPF
NTKYSSIVLSHPDFAGLHFTGSYSTFVRLWKMIAQNLDKYRNFPRIVGETGGKDFIVVHP
SADITEAVVATIRGAFEYQGQKCSAASRLFVPKSMWPRFWEAMKAELDKVKVGPVDDFTV
FMGAIISEEQFRKIVSYIEYAKQHPEEYQIIYGGKYDDSKGYFIWPTVVLTNNPKGKLMT
EEIFGPVLTVYVYDDDKYDEILWVVDKAAPYGLTGSVFAKDREAILKAEKALRYAAGNFY
INDKPTGSIVARQPFGGARWSGTNDKAGWFTNLLRWLNPRSIKETLVPPKEWRRPYMGED
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
gtggctttatggaggatagagaagcctaagaacgagcctttcctggagtttaggcctggg
actaaggagagggagcttctaaagaagaagctcgaggaggttaagagtaagaccgtcgag
atccccctgataatcggggggaaagaggtcaagactggtgagaccgtcgagatacgcgcg
ccccacgataaggatgccgtgctggctgtagcccaccttgctggggaggaggagataagg
gatgccatagagaaggccctggacgcttggacaaagtggtccgagatggagtggtaccac
agggcctcagtcttcctgaaggctgcagacctgctggcggggccctacaggcttgaggcc
gatgctgtcataatgcttaaccactcgaagacgccgtgggaggcggagatagacctggca
gaactcgtggacttctggaggtttggggcctactatgctagattcatcttcgaacagcag
cctgagcaggctcccggcgagctaaacagggtcgagtggcggcctctagagggcttcgta
ttcgcagttcccccgttcaacttcttcagcataggaggtaacctgcccaccgcccccgcg
ctcgtggggaacgtgtcgatatggaagccttccagatgggttatatactccaactacata
ataatgaggatcctgatggaggctgggctacctccgggcgtggtaaacttcgttcccttc
aacaccaagtactcgagcatagtgctctcccacccagacttcgcaggcctccacttcaca
gggagctactcaactttcgtcaggctctggaagatgatagcgcagaacctggacaagtac
aggaacttccccaggatagtgggcgagacgggcggtaaagacttcattgtggtccacccg
agcgcagacataaccgaggcagtggttgctacgataagaggagccttcgagtaccagggg
cagaagtgcagcgctgcctccaggctattcgtacccaagagcatgtggcccaggttctgg
gaggccatgaaggcggagctggataaggttaaggtcgggccggttgacgacttcacagta
ttcatgggcgccataataagcgaggagcagtttaggaagatagtctcctacatagagtat
gctaagcagcatcccgaggagtaccagataatctacggtggcaagtatgatgacagtaag
ggctacttcatatggcctactgtcgtgctcaccaacaacccgaagggcaagctgatgaca
gaagagatcttcggccctgtgctcacggtctacgtgtatgacgacgacaagtatgatgag
atactgtgggttgtggacaaggcagctccctacggactaacagggtccgtgttcgcgaag
gatagggaggccatactcaaggcggagaaggcgcttaggtatgcagcaggcaacttctac
ataaacgacaagccgacaggatccatagtggctagacagcccttcggaggcgccagatgg
tcgggcaccaacgacaaggcaggctggttcacaaacctcctaaggtggctgaacccgaga
tcgataaaggagaccctagtgccgccgaaagagtggagaagaccctatatgggagaggac
tag

DBGET integrated database retrieval system