KEGG   Aeropyrum pernix: APE_0816
Entry
APE_0816          CDS       T00023                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K15450  tRNA wybutosine-synthesizing protein 3 [EC:2.1.1.282]
Organism
ape  Aeropyrum pernix
Brite
KEGG Orthology (KO) [BR:ape00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ape03016]
    APE_0816
Enzymes [BR:ape01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.282  tRNAPhe 7-[(3-amino-3-carboxypropyl)-4-demethylwyosine37-N4]-methyltransferase
     APE_0816
Transfer RNA biogenesis [BR:ape03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    APE_0816
SSDB
Motif
Pfam: TYW3
Other DBs
NCBI-ProteinID: BAA79794
UniProt: Q9YDV3
Structure
PDB: 
2DVK

Position
541718..542284
AA seq 188 aa
MGSIEEVLLEERLIGYLDPGAEKVLARINRPSKIVSTSSCTGRITLIEGEAHWLRNGARV
AYKTHHPISRSEVERVLRRGFTNLWLKVTGPILHLRVEGWQCAKSLLEAARRNGFKHSGV
ISIAEDSRLVIEIMSSQSMSVPLVMEGARIVGDDALDMLIEKANTILVESRIGLDTFSRE
VEELVECF
NT seq 567 nt   +upstreamnt  +downstreamnt
atgggtagtatagaggaggtgcttttggaggagaggctcataggatatctagaccccgga
gccgagaaagttttagcgaggataaacaggccttcaaaaatagtgtctacaagcagttgt
acagggaggataacactgatcgagggcgaggctcactggctcaggaacggggcaagagta
gcgtacaagacccatcaccccatatcccggagtgaggttgaaagggttctaaggaggggc
ttcacaaacctttggctcaaggtgaccggccctatactacatctcagggttgaggggtgg
cagtgtgcaaagtcccttctcgaggcagctaggagaaacgggttcaagcacagcggagtc
ataagcatagctgaggattcaagactcgtcatagaaataatgagcagccagagcatgtca
gtacctctagttatggagggtgctaggatagtcggcgacgatgccctagatatgctgatt
gagaaagcaaacactatactagttgagtctagaatcgggctagacacgttttcaagagag
gtcgaagagcttgtcgaatgcttttaa

DBGET integrated database retrieval system