KEGG   Aeropyrum pernix: APE_0867.1
Entry
APE_0867.1        CDS       T00023                                 

Definition
(GenBank) hypothetical protein
Organism
ape  Aeropyrum pernix
SSDB
Motif
Pfam: Phage_sheath_1
Other DBs
NCBI-ProteinID: BAA79847
UniProt: Q9YDQ0
Position
567135..568112
AA seq 325 aa
MFEGSEYLYPLYRHLYGLGLTREEWLRAREAFRERARRCPRCAFMDVGLAARHARSLRQW
MRSPNRYDIPGVDSPEVGWWLESRDLLEPYSEESKSILGEVERARRAVELYFGEPVATRV
RVRYEEEMDKPGVLGYWEHRPGWDYGVLAVKRGLGERFKDVVVHELVHAWSLGRYSDVPY
GEKAGNPAWNMRVVEGSTETAAKRVLSLLGLKPSAVAYSALVERLSEGGAERGVEAALEF
LRAARERRRPRGEYMREAVLLKHTEGPDVYVSKPPERLPGEARDLLSPKPFPAELALDRT
LRPFAEALKTLRRQRRRGGRRRRWG
NT seq 978 nt   +upstreamnt  +downstreamnt
ttgttcgagggcagcgagtacctctaccccctctacaggcacctatacgggcttggcctg
actagggaggagtggctccgtgccagggaggcgttcagggagagggctaggaggtgtccg
cgctgcgcctttatggacgtcgggctggcggccaggcacgctaggtcgctgaggcagtgg
atgaggtcgcccaacaggtacgacatacccggcgttgactccccggaggtgggctggtgg
ctcgagtcccgggatctcctggagccttatagtgaggagtccaagagcatcctgggcgag
gttgagagggctaggagggcggtggagctttacttcggcgagccggtggccacgagggtc
agggttaggtacgaggaggagatggataaaccgggggttctggggtactgggaacacagg
cccggctgggactatggagtgctggccgttaagagggggctgggcgagaggttcaaggac
gtggtcgtccacgaactggtgcacgcctggagcctcggcaggtacagcgacgttccttac
ggggagaaggcggggaacccggcgtggaacatgagagtggttgagggtagcacggagacg
gctgccaagcgggtgctctcgttgctgggcttgaagccgtccgcagtggcctactcggcc
ctcgtcgagaggctctcggaggggggcgcggagaggggtgtagaggcggccctcgagttc
ctccgggcggccagggagaggaggcggcctaggggcgagtacatgagggaggctgtgctg
ctgaagcacacggaaggccccgacgtctacgtgtcaaaaccgccggagaggctccccggg
gaggcgagggacctgctctcgcctaaacccttccccgccgagctcgccctcgacaggact
ctgaggcctttcgcagaagcccttaaaaccctcaggaggcagaggaggaggggcgggagg
aggcggcgttggggctag

DBGET integrated database retrieval system