KEGG   Aeropyrum pernix: APE_0875.1
Entry
APE_0875.1        CDS       T00023                                 
Name
(GenBank) U/G and T/G mismatch-specific DNA glycosylase
  KO
K03575  A/G-specific adenine glycosylase [EC:3.2.2.31]
Organism
ape  Aeropyrum pernix
Pathway
ape03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ape00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    APE_0875.1
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ape03400]
    APE_0875.1
Enzymes [BR:ape01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.31  adenine glycosylase
     APE_0875.1
DNA repair and recombination proteins [BR:ape03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     APE_0875.1
 Prokaryotic type
     APE_0875.1
SSDB
Motif
Pfam: HhH-GPD EndIII_4Fe-2S HHH
Other DBs
NCBI-ProteinID: BAA79857
UniProt: Q9YDP0
Position
573589..574260
AA seq 223 aa
MLFLDKGRIEALRRRLIEWYRVYGDKDLPWRNTADPWAILVAAFLLRKTTARQVVRVYEE
FLRRYPNPKALASAREDEVRELIRPLGIEHQRAKHLIELAKHIEARYGGRIPCSKEKLKE
LPGVGDYIASEVLLAACGSPEPLLDRNMIRILERVLGVKSAKKRPHTDPKMWSTARRIVP
KDPDMAKEFNYGMLDLARKICTARKPLCTECPLNDICIYYNND
NT seq 672 nt   +upstreamnt  +downstreamnt
gtgctctttctggataaaggcagaatcgaggctctcaggaggagattgatagagtggtat
cgcgtgtacggggataaagatctgccctggaggaacactgctgacccctgggccattctg
gttgcggcgttcctgcttagaaaaactacagctaggcaggttgtaagagtgtatgaagaa
ttcctcaggaggtaccccaatccaaaggcgctggcgagtgccagggaggatgaggttaga
gagctcatccgcccgctgggcatagagcaccagcgcgccaagcacctgattgaacttgca
aagcatatagaagcaagatatggcggtaggattccgtgctcgaaggagaagctgaaggag
ttgccgggggtaggggactacatagcctcagaagtcctcctagcagcctgcggctccccc
gagccgctcctggacaggaacatgataaggatcctagagcgagtgcttggtgtgaaatcc
gctaagaagaggcctcacacagaccccaaaatgtggtctacggccaggaggatagtgccg
aaagacccggatatggcgaaggagttcaactacgggatgctggacctggcaaggaaaata
tgcaccgctagaaagcctctgtgcaccgaatgcccgttaaatgatatttgtatatactac
aacaatgattaa

DBGET integrated database retrieval system