KEGG   Aeropyrum pernix: APE_1098
Entry
APE_1098          CDS       T00023                                 

Definition
(GenBank) RNA (cytosine-C(5)-)-methyltransferase
Organism
ape  Aeropyrum pernix
SSDB
Motif
Pfam: Methyltr_RsmB-F PUA FtsJ UPF0113 Fibrillarin
Other DBs
NCBI-ProteinID: BAA80083
UniProt: Q9YD14
Position
695697..696863
AA seq 388 aa
MTSPAPLCGTSIAYDAGLAEVLEASSGPLCSLLASLERPPPRLYVRVNTLKVGVDRYLEM
LRGVGLEFRVDEDIPEAIWHPVEGPFSWEFRGKRVVADKVASESVLMGSDLYAPGVVYAR
GVERGDEVVIVAPNGRVVGGGVAVMSWREMRRAGRGLAVRVTKPIYRAPRVSELPGFREG
LVYGQSVTSMYVARALDPRPGWVVVDLNAAPGGKVSHVAQLAGREAVIVAIDRPSKVGRL
RETLERLGAGWVRVVGGDSRRASRLLPGLAGRVDAVLVDPPCTNIGVIPKVFDVKTLRDS
AAASRYQWMFVEEAWRLLRRGGLLAYSTCTLSSLENELIVARAEELGFRLTWSWGLRPSR
GRRSWLGFRWEPHRDGTPGFFLAILEKP
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgacctcccccgcgcccctctgtggcactagtatagcgtatgacgctggcctcgccgag
gtcctcgaggcctcctccgggcccctatgcagcctgctagccagcctggagaggcctcct
cccaggctttacgttagggttaacacgctgaaggtcggtgtagaccgctacctggagatg
ctgaggggtgtggggctggagtttagggttgacgaggatattccagaggccatttggcac
cctgtggaggggcccttctcctgggagttcagggggaagagggttgtcgccgacaaggtg
gccagcgagagcgtcctcatgggcagcgacctctacgcgccgggggtggtttacgccagg
ggtgttgagaggggtgacgaggttgttattgtggcgccgaacgggagggtcgttggcggc
ggcgttgctgttatgtcgtggcgagagatgaggagggctggcaggggcctggctgtgagg
gtgacgaagccgatatacagggctcccagggtctcggagcttccggggttcagggagggc
ctggtgtacggtcagagcgtcacctcgatgtacgtggccagggctctcgacccgaggccg
gggtgggttgtggtcgacttaaacgccgcccccggggggaaggttagccacgtcgcccag
ctggcggggagggaggcggtgatagtggctatagacaggccgagcaaggttgggaggctg
agggagactctggagaggctgggggccgggtgggtgagggtggtggggggagatagcagg
agggcctcccgcctcctacccgggctggcggggagggttgatgcggtcctcgtcgaccct
ccgtgcacgaacataggcgtcatacccaaggtgttcgacgtcaagaccctcagggacagc
gccgccgcatcccgctaccagtggatgttcgtggaggaggcctggaggctcctgaggagg
gggggcctgctggcctactccacctgcaccctctccagcctggagaacgagcttatagta
gcgagggcggaggagctgggcttcaggctcacatggagctgggggttgcggccgagcagg
gggaggaggagctggctggggttcaggtgggagccgcacagggacgggacgcccggcttc
ttcctcgcgatactcgagaagccctag

DBGET integrated database retrieval system