KEGG   Aeropyrum pernix: APE_1239.1
Entry
APE_1239.1        CDS       T00023                                 
Symbol
cas4
Name
(GenBank) putative CRISPR-associated protein Cas4
  KO
K07464  CRISPR-associated exonuclease Cas4 [EC:3.1.12.1]
Organism
ape  Aeropyrum pernix
Brite
KEGG Orthology (KO) [BR:ape00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:ape02048]
    APE_1239.1 (cas4)
Enzymes [BR:ape01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.12  Exodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.12.1  5' to 3' exodeoxyribonuclease (nucleoside 3'-phosphate-forming)
     APE_1239.1 (cas4)
Prokaryotic defense system [BR:ape02048]
 CRISPR-Cas system
  Type I CRISPR-Cas system
   Subtype I-A factors
    APE_1239.1 (cas4)
   Subtype I-B factors
    APE_1239.1 (cas4)
   Subtype I-C factors
    APE_1239.1 (cas4)
   Subtype I-D factors
    APE_1239.1 (cas4)
  Type II CRISPR-Cas system
   Subtype II-B factors
    APE_1239.1 (cas4)
SSDB
Motif
Pfam: Cas_Cas4 PDDEXK_1 Csa1
Other DBs
NCBI-ProteinID: BAA80228
UniProt: Q9YCL9
Position
complement(783636..784235)
AA seq 199 aa
MRPVSMLKEYAYCPRVAYYMEVLRPSYRPTEPMNLSREIYSVDHVRGILRSSGFRIVKEE
WAVPLRSKRLGLQGVADGVVVEGSLGIIVVEAKLSVRSNRWLHTRGRHVIFQAAAYALAL
EETRGYSVDYLAIVSLEDSKTYVVKMSPSLRRDVIRLADDMNKTLDDGLEPPPKPGRKCV
ACRFRRVCQPWVAERGSER
NT seq 600 nt   +upstreamnt  +downstreamnt
ttgaggccggtgtctatgctgaaggagtatgcgtactgtccgcgtgtcgcttattatatg
gaggttcttaggccttcatacaggcctacagagcctatgaatctctctcgcgagatttat
agcgtggaccatgttagggggatcctaagatcctctggcttcagaattgtgaaggaggaa
tgggctgtacccttgaggagcaagcgtctagggctgcagggtgttgcagacggggtagtt
gtcgaggggagtttgggcattatagtcgtcgaggcgaagctaagtgtaaggtctaataga
tggcttcacactaggggtcgccatgttatctttcaggccgctgcctatgcactagccctc
gaagagaccagaggatattctgttgactacctagctatcgtttcgctggaggattctaaa
acttacgttgttaaaatgtcccctagcctgagacgtgatgtgatcaggctagctgacgat
atgaacaaaaccctggacgatggtctagaacctcctcccaagccaggtagaaagtgtgtg
gcatgcaggttcaggagggtgtgccagccttgggtagcagagagaggttcagaaaggtga

DBGET integrated database retrieval system