KEGG   Aeropyrum pernix: APE_1273.1
Entry
APE_1273.1        CDS       T00023                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K00763  nicotinate phosphoribosyltransferase [EC:6.3.4.21]
Organism
ape  Aeropyrum pernix
Pathway
ape00760  Nicotinate and nicotinamide metabolism
ape01100  Metabolic pathways
ape01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:ape00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    APE_1273.1
Enzymes [BR:ape01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.21  nicotinate phosphoribosyltransferase
     APE_1273.1
SSDB
Motif
Pfam: QRPTase_C QRPTase_N NAPRTase_C NAPRTase_N BtpA
Other DBs
NCBI-ProteinID: BAA80263
UniProt: Q9YCI4
Position
complement(804586..805758)
AA seq 390 aa
MSGGQPRIYMASLGEILEGRATDIYFVRTRRVAEKYGVGGKRVRMEVHAYSLPRGYEWAV
YAGLEEALALLQGKPVTVYSLPEGTVFERKDPLMVVEGRFQDIILFETALLGLLRFSTSI
ATKAARVRLAAGRGKTVLFFGLRALHPAVQPAADRAALVGGLDGVSGVLSREYLGVEPRG
TMPHALIIVFGSQVEAWRAFAETFKEETPVIALVDTFWDEREEALMAARELGEVLAGVRL
DTPSSRRGRMRDIVEEVRWALDIHGYKHVKIFVSGGLDEERVAELRDVADGFGVGTTIAA
APNIDISMDVVEVHEDGEWRPRTKRGKLPGARSIVLCRGEKRIVRLGEEPEGCEPLTRKY
LEEGRLAQSLPSLDEIRSYVLKQLENLGLQ
NT seq 1173 nt   +upstreamnt  +downstreamnt
ttgagcggggggcagcccaggatatacatggcgagcctgggcgagatactggagggcagg
gccaccgacatctacttcgtaaggacccggagggttgcggagaagtatggagtggggggt
aagagggttaggatggaggttcacgcctacagcctcccccgtggttatgagtgggctgtc
tatgctgggcttgaggaggcgctcgcgctcctccagggcaagcccgtcaccgtctacagc
ctgcctgaggggacggtcttcgagaggaaggaccccctgatggttgtggagggtagattc
caggatataatactctttgagaccgccctcctagggctactcaggttctccacgagcata
gcgacgaaggcggccagagtaaggcttgcggcgggcagggggaagacagtcctgttcttc
ggcctcagggccctccaccccgccgtacagcccgccgcggatagggcagcgctggtgggc
gggctggacggggtgagcggggtcctaagcagggagtacctcggcgtcgagccccgcggt
accatgccccacgccctaataatagtcttcggcagccaggtggaggcttggagggcgttc
gccgagaccttcaaggaggagacgccggtcatagctcttgtcgacacgttctgggacgag
agggaggaggccctcatggccgccagggagctcggcgaggtcctcgctggcgtgaggctc
gacacgccgagcagcaggagggggaggatgagggatatcgtggaggaggttaggtgggcc
ctggacatccacggctacaagcacgtcaagatattcgtcagcggcgggctagacgaggag
agggtcgcggagctcagggacgtggccgacggcttcggagtgggcaccaccatagcagcc
gcccccaacatcgacataagcatggacgtggtggaggtccatgaagacggcgagtggagg
ccgaggaccaagaggggcaagctacccggggcgagatccatcgtcctctgccggggcgag
aagaggatcgtaaggctcggggaggagcctgagggctgcgagcctctgacccgcaaatac
ctcgaggaaggccgcctagcccagagcctgccgagcctcgatgagatcaggagctacgtc
ctcaaacagcttgaaaacctaggcctccaataa

DBGET integrated database retrieval system