KEGG   Aeropyrum pernix: APE_1323.1
Entry
APE_1323.1        CDS       T00023                                 
Name
(GenBank) single-stranded DNA binding protein
Organism
ape  Aeropyrum pernix
SSDB
Motif
Pfam: tRNA_anti-codon CDC24_OB3 REPA_OB_2 PS-DH
Other DBs
NCBI-ProteinID: BAA80315
UniProt: Q9YCD3
Position
838501..838956
AA seq 151 aa
MEGDRTRIMDLREGLRNVSISGRVLETGEPKMVETKRGPATLSEAVVGDESGRVKVTLWG
SHAGTLKEGEAVRIEGAWTTSYRGKVQVNVGRESTIEKVDSEDVPQAEDIPEEMPEAQYR
GFGQRQPYRSGGFGGFRGGGYQPRRGGRRRF
NT seq 456 nt   +upstreamnt  +downstreamnt
ttggaaggagatagaacccgtattatggacctaagggagggtcttaggaacgtctcgatc
tctggccgcgtccttgagacgggagagcccaagatggttgaaaccaagagaggccctgca
accctgagcgaagccgttgtaggcgatgagagtggtagggttaaggtgactctctgggga
agccacgcgggaacactaaaggagggcgaggccgttaggatagagggcgcctggacaacc
agctacaggggcaaagtccaggtcaacgtcggcagagagtcgaccatagagaaggtggac
tccgaggatgtaccccaagcggaggacatacccgaggagatgccggaggcccagtatagg
ggcttcgggcagaggcagccttacaggagcggcggtttcggcggcttcagaggaggcggc
taccagccccgaagaggaggcaggaggaggttctag

DBGET integrated database retrieval system