KEGG   Aeropyrum pernix: APE_1336.1
Entry
APE_1336.1        CDS       T00023                                 

Definition
(GenBank) putative phytoene dehydrogenase
Organism
ape  Aeropyrum pernix
SSDB
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_oxidored FAD_binding_2 Thi4 HI0933_like GIDA Pyr_redox_2 Pyr_redox FAD_binding_3 Lycopene_cycl Trp_halogenase GMC_oxred_N 3HCDH_N AlaDh_PNT_C
Other DBs
NCBI-ProteinID: BAA80328
UniProt: Q9YCC0
Position
complement(846253..847902)
AA seq 549 aa
MGGERVFDVVVVGGGHNGLTAASVLARRGLRVALLEARERLGGLAASYSPWPGFTAPFGA
YVLGLYPRWLMREAGIEGRVRLLPKDPGMTVVLGEGRALRVYGDARRTSREFSRVSPADG
EAYLRWARLWSALGVLLEEVYSHPPLSPREVVEHAYRAARTPLVGRIVEEALEAAQWMLT
APAARILGEWFESWEARAALVEDALVGEMAAPSTPGTGIVLAHHYLGVSTGRRGEWAYVK
GGMGRLIHALAEAAREAGASIETGARVSEVLVESGRAVGVRTWDGRVYRARKAVLWAASI
KTLPSVVELDRGLARRIRTLESSGASSKIVLAAREPLKPAEEYRWLGEDLYTSSVITMPG
MEYAEKAYGEAVSRGVSREPWLSVNVLNRVDPGLAPEGWILASIFLQYTWRPARSWGEED
KSEVAERGLGVLESVFTLPREGVRVEVLTPRDYEGLGNPGGSIFHISMRLDQLYSSRPLP
EASGYTLPGVDRLYLASASSHPGGGVSGLPGWLASRRLLEDLGVEKPRRLSLEKLALKMA
RSAREMLGR
NT seq 1650 nt   +upstreamnt  +downstreamnt
ttgggtggcgagagggttttcgacgttgttgtagtggggggaggccataatgggctgaca
gccgcctccgtcctggccaggcgcggcctgagggtggccctcctcgaggccagggagcgt
cttggagggcttgcagcctcctactcgccctggcccgggttcacagcgcctttcggggcg
tacgtcctcggcctctaccccaggtggcttatgagggaggcgggcatcgagggtagggta
cggctgctgcctaaagaccctgggatgacggtggtgctgggtgagggcagggctctgagg
gtgtatggagacgcccggaggacctcgagagaattctccagggtttcgccagcggatgga
gaggcctatctaaggtgggctaggctctggagcgccctgggtgtgctgcttgaggaggtt
tacagccaccctcccctcagccctcgcgaggttgtggagcacgcctacagggctgccagg
acgccgctggtggggaggattgtggaggaggccttagaggctgcccagtggatgctcaca
gccccggcggccaggatactgggggagtggttcgagagctgggaggcccgggcggccctt
gtggaggacgccctggtgggggagatggccgccccctctacgccgggcacggggattgtg
ttggcgcaccactacctcggagtctccacgggtaggaggggagagtgggcttacgtcaag
ggcggcatgggcaggctaatccatgccctcgccgaggctgctcgggaggcgggggcctca
atcgagacgggcgccagggtgtcggaggtcctcgtggagagtgggagggccgtgggggtg
aggacatgggatggcagggtgtatagggcgaggaaggcagtcttgtgggccgcgagcatc
aaaacactacccagcgtggtcgagctcgacagggggcttgctaggaggataaggactctt
gaatcatcgggagcatcgtcaaaaatagtgctcgcggccagggagcccctgaagccggcg
gaggagtataggtggctcggcgaggacctctacaccagcagcgttataacaatgccgggg
atggagtacgccgaaaaggcctacggagaagccgtctcaaggggggttagcagggagccc
tggctctccgtgaacgtgctgaacagggttgacccggggcttgcccccgaggggtggata
ctcgccagcatattcctccagtacacgtggaggcccgccaggagctggggtgaggaggat
aaaagcgaggttgcagagagggggctcggagtgctggaaagcgtcttcaccctgccgagg
gagggggttagggttgaggtcctcactcccagagactacgaggggctggggaaccctgga
ggcagcatattccacatctccatgaggctcgaccagctatactcctctcggccactgcca
gaggcctccggctacaccctgccgggcgtcgaccgcctctacctagcctccgcctccagc
caccccggcggcggtgtgtcggggctgccgggctggctggcatcaaggaggcttctcgag
gacctgggggtggagaagcctaggagactcagccttgaaaagctcgccctcaagatggcg
agatccgcccgggagatgctgggccgctag

DBGET integrated database retrieval system