KEGG   Aeropyrum pernix: APE_1436.1
Entry
APE_1436.1        CDS       T00023                                 
Name
(GenBank) repair endonuclease XPF
  KO
K10848  DNA excision repair protein ERCC-4 [EC:3.1.-.-]
Organism
ape  Aeropyrum pernix
Pathway
ape03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ape00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    APE_1436.1
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ape03032]
    APE_1436.1
   03400 DNA repair and recombination proteins [BR:ape03400]
    APE_1436.1
Enzymes [BR:ape01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-
    3.1.-.-
     APE_1436.1
DNA replication proteins [BR:ape03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other termination factors
    APE_1436.1
DNA repair and recombination proteins [BR:ape03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     APE_1436.1
SSDB
Motif
Pfam: ERCC4 HHH_5 HHH HHH_2 HHH_3 IMS_HHH 5_3_exonuc UPF0758_N Transposase_20 RNA_pol_A_CTD
Other DBs
NCBI-ProteinID: BAA80433
UniProt: Q9YC15
Structure
Position
complement(912114..912860)
AA seq 248 aa
MEGGRYRRGGFRPRVYVDVREERSPVPSILESLGVQVIPKQLPMGDYLVSDSIIVERKTS
SDFAKSLFDGRLFEQASRLAEHYETVFIIVEGPPVPRRYRGRERSLYAAMAALQLDYGIR
LMNTMDPKGTALVIESLARLSTREGGQRIVIHKKPRLSDVREWQLYILQSFPGIGRRTAE
RILERFGSLERFFTASKAEISKVEGIGEKRAEEIKKILMTPYKRSTGGGRRHASLDDFYR
GEGEAGSG
NT seq 747 nt   +upstreamnt  +downstreamnt
ttggagggcgggcgctacaggcgaggcggatttaggcctagagtttatgtggatgttagg
gaggagaggagccctgttccttctattctcgagagccttggggtacaagttatacctaag
cagctccccatgggggattaccttgtctccgactctattatagttgagaggaagactagc
agcgacttcgccaagagcctcttcgacggtaggctgttcgagcaggcttccaggcttgcg
gagcattatgaaaccgtcttcataatagttgaaggacctcctgtgcccaggcgttacaga
gggagggagaggagcctctacgccgctatggccgccttacagctggactatgggattagg
ttaatgaacactatggacccgaaggggacggcgctggtgatagagagcctcgcccgcctc
tccactagagagggtggtcagaggattgttatacataagaagccccgcctctctgacgtg
agggagtggcagctctacattctccagtcattcccaggcattgggaggagaacggcggag
aggatattagagaggttcgggagcctggagaggttcttcacggcctccaaggcagagata
tcgaaggtggagggcataggcgagaagagggcggaggagattaagaagatactcatgaca
ccttacaagagaagcaccggaggggggagaaggcatgccagccttgacgacttctataga
ggcgagggggaggctggttctggataa

DBGET integrated database retrieval system