KEGG   Aeropyrum pernix: APE_1454.1
Entry
APE_1454.1        CDS       T00023                                 

Name
(GenBank) cation-transporting ATPase
  KO
K17686  P-type Cu+ transporter [EC:7.2.2.8]
Organism
ape  Aeropyrum pernix
Brite
Enzymes [BR:ape01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.8  P-type Cu+ transporter
     APE_1454.1
SSDB
Motif
Pfam: E1-E2_ATPase Hydrolase HMA Hydrolase_3 HAD Hydrolase_6 HMA_2 DUF6286
Other DBs
NCBI-ProteinID: BAA80452
UniProt: Q9YBZ6
Position
923066..925582
AA seq 838 aa
MSGVTLVKEKLSIKGMHCATCGLTVEKALRSLPGVVEASADPVTGEAVIAYEPGSVRLSD
VVKAIRSVGYDVVLAEAVIRVPSMSSIDDERVVEETLLKMKGVAEVYASHTNKTVVVRYN
PHATKPEEVLEALRKAGYKAEMAEGKSLVEAEAEEERRLLLDGLISITASIVYYILLALE
RLAGVEAAGAVLPYYGAVVFAIVLLGPGRRFLVGAYRSLKNGTPGMDALVSLGTLSIYFY
SLAATLNIIRGELYYEGIGLIIGFVLIGRYIESKVKKGTGKAVENLAKLKPQKARVLRGR
REVEVDVSEVKPGDLVVVRQGERIPVDGYVVQGKAYVDESVFTGEPIPVEKKPGDLVLAG
SMVSSGWLHISATRTSGDTAIDRIARLIAYSQAGKMDIQRLADRVSGMFFWAVLCIASLT
FTAWLFLGGLETAIIRAASVFLISCPCALGLATPTASSAGVGVAARAGILVRNVVAFERL
AKASIVVFDKTGTLTLGMPRVAAVEAVDGYSEKEILELAASAEKWSEHPLARAIIDAYME
VAGRGPEDPDNAEVFPGMGVYAEVGGRSVVVGNRKIMDGFEVDIKTLEKIAEEWQSRGAT
TVFVAIDGKPAGVIAIRDEPRPEARETVDWLEKLGLKVMMLTGDSEGTARAIARELDIEE
YRAGVSPEGKAEVIRELQKKGHVVVMVGDGVNDAPSLARADVGIAVANATDVSVEAGDIV
LIKGDLRRVPLAVVISRKTYNTIKFNLFWAFIYNVTLIPVAAGAFAWAGITLRPELAAAA
MALSSITVTSISYRLSKWKPRLPGDYETYDNKEEKEESKEEFERITREEKALAAGRQQ
NT seq 2517 nt   +upstreamnt  +downstreamnt
ttgtcgggtgtgacgctagtcaaggagaagctctcgataaaggggatgcactgtgccacc
tgcggccttactgttgagaaggccctgagaagccttccaggcgtggtagaggcctcggca
gatcccgtaactggagaggcagttatagcgtatgagccgggctccgtaaggctttccgac
gttgttaaagcgatcaggtctgtgggctatgatgttgtgctcgctgaggccgtgataagg
gttccctcaatgagtagtatcgacgacgagagagttgtcgaggagactctcctcaagatg
aagggtgtggccgaggtctatgcttcccacacaaacaaaaccgtggtcgtcaggtacaat
cctcacgccaccaaaccggaggaagtgctggaggctctgcggaaggcgggatacaaggct
gagatggctgagggaaagagtcttgtggaggcggaggcagaagaggagagacgcttactc
ctggacggtctaatcagcattacagccagcatagtctactacattctactggctcttgag
aggcttgctggggtggaagccgctggggcggttctgccctactatggagccgtggtcttc
gccatcgtactcctaggccctgggagaaggtttctagtcggtgcctacaggagcttgaag
aacggcacacccggtatggacgccctggtcagcctcggcacactatcgatctacttctat
agcctcgctgcaaccctaaacataataaggggagagctctactacgaggggataggccta
ataataggctttgtcctaatcggaaggtacatagagtcgaaggttaagaagggaactggc
aaggctgtcgagaacctagcaaagctcaagccgcagaaagctagagttctaaggggtagg
agggaggttgaggtcgatgttagcgaggtcaagccaggagacctcgtggttgtaagacag
ggtgagaggattcctgtagacggctacgtcgtccaggggaaggcctatgtcgacgagagc
gtgtttacaggggagcccatccctgttgagaagaagccgggggatcttgttctagccggc
tcaatggtatcttcaggctggctccacatatcagcaaccagaacctcgggtgacacggct
atagacaggatagccaggctcatagcctacagccaggctggcaagatggatatacagagg
cttgctgacagggtttcaggaatgttcttctgggctgtcctctgtattgcttcgctaacg
tttacggcatggctcttcctgggcgggcttgagacagctataataagggctgccagcgtt
ttcctaatatcatgtccatgcgccctggggctggcaacgcccacagccagctcagcaggg
gtcggagtggctgccagggccggaatacttgttaggaacgtggtggcgttcgagaggcta
gcgaaggcgtctatagtggttttcgacaagacagggacgttgaccctgggcatgccgagg
gttgcggctgtggaggctgtagacggctacagcgagaaggaaatacttgaactggcggct
tcagcggagaagtggagcgagcaccccctggccagggctattatagacgcctatatggag
gtggcaggcagggggcctgaggatcctgataacgcagaggtattccctggtatgggtgtc
tacgcagaggtgggaggccgctcggtggttgttggtaacaggaagattatggacgggttc
gaggtagatatcaagactctggaaaagattgcagaggagtggcagtcaagaggggcaaca
acggttttcgtcgcaatcgatggaaagcccgctggggttatagccatcagagacgagcct
agaccggaagccagggagacggtagattggctggagaagcttggcctgaaagtgatgatg
ctcacaggcgattcagaaggcacagcccgggctatagcgagggagctggacatagaggag
tacagggccggggtcagccctgagggcaaggcagaggtgataagggagctccagaaaaag
ggtcatgtagttgtaatggtgggcgacggggtcaacgacgcgccaagcctagccagggct
gacgtgggaatagctgttgcaaacgctaccgacgtcagcgtcgaggctggtgacatagtc
ctcataaaaggcgaccttcgacgtgtccccctagcagtggtaatatcgagaaagacatac
aacactattaaattcaacctcttctgggcgttcatatacaacgtcaccttgatacccgta
gcggcaggagcctttgcctgggcaggaataacacttaggccagagctagcagcagcggca
atggcgctaagcagcataacagtaacgagcataagctataggcttagcaaatggaaacca
agattaccgggcgattacgaaacttatgataacaaagaggagaaggaggagtcaaaagaa
gagttcgagaggataacgcgagaggagaaggctctagccgccgggagacaacagtag

DBGET integrated database retrieval system