KEGG   Aeropyrum pernix: APE_1657.1
Entry
APE_1657.1        CDS       T00023                                 

Definition
(GenBank) aldolase class II protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
ape  Aeropyrum pernix
Pathway
ape00040  Pentose and glucuronate interconversions
ape00051  Fructose and mannose metabolism
ape01100  Metabolic pathways
ape01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ape00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    APE_1657.1
   00051 Fructose and mannose metabolism
    APE_1657.1
Enzymes [BR:ape01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     APE_1657.1
SSDB
Motif
Pfam: Aldolase_II EccE
Other DBs
NCBI-ProteinID: BAA80658
UniProt: Q9YBE0
Position
1048988..1049587
AA seq 199 aa
MFYPPRGPIDKSVMADVAEALKTLYERGLVQAMGGNVSALHNGLVYLSPTRVFRGRLSWM
DVAVMRLDGSVVRGRPSSEWRMHIAIYRRLDGIAAVVHAHPPALLGADSTGLRLNPSLLM
EAEATVGCVAGVPRVKPGTWELAEAVATALEASGCRAAVLRNHGVVAVGRSLWEALDMAE
AVEDLARISLYQRLGGGGV
NT seq 600 nt   +upstreamnt  +downstreamnt
gtgttctaccctccaagaggccctatagataagagtgtcatggccgatgtcgcagaggcc
cttaagacactctacgagaggggtctcgtccaggcgatgggaggcaatgtttccgcgctg
cacaacggcctagtctacttatcgccgacgcgtgttttcagaggcaggctgagctggatg
gacgtggcagtcatgaggcttgacggcagtgtagttagggggaggcccagcagcgagtgg
aggatgcacatcgccatatatagacgcctagatggcatcgcggccgtcgtccacgcccac
cccccagccctcctcggggcggactcgacggggcttaggctcaaccccagcctcctcatg
gaggccgaggccaccgtaggctgtgtggcgggggtaccacgggtcaaacctggcacctgg
gagctggccgaggccgtggccactgctctagaagcctccggctgtagagccgcagtgctc
aggaaccatggagttgtggctgtgggtagaagcctctgggaggccctcgatatggctgaa
gcagttgaggacctcgccagaatcagcctgtaccagaggctgggcggcggaggcgtatag

DBGET integrated database retrieval system