KEGG   Aeropyrum pernix: APE_1677.1
Entry
APE_1677.1        CDS       T00023                                 

Gene name
pdhA
Definition
(GenBank) pyruvate dehydrogenase E1 component, alpha subunit
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
ape  Aeropyrum pernix
Pathway
ape00010  Glycolysis / Gluconeogenesis
ape00020  Citrate cycle (TCA cycle)
ape00620  Pyruvate metabolism
ape01100  Metabolic pathways
ape01110  Biosynthesis of secondary metabolites
ape01120  Microbial metabolism in diverse environments
ape01200  Carbon metabolism
Module
ape_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ape00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APE_1677.1 (pdhA)
   00020 Citrate cycle (TCA cycle)
    APE_1677.1 (pdhA)
   00620 Pyruvate metabolism
    APE_1677.1 (pdhA)
Enzymes [BR:ape01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     APE_1677.1 (pdhA)
SSDB
Motif
Pfam: E1_dh DXP_synthase_N TPP_enzyme_C
Other DBs
NCBI-ProteinID: BAA80678
UniProt: Q9YBC0
Position
complement(1057931..1059064)
AA seq 377 aa
MEEYKTLLEDALGFKRAVDEEGRVVDEELLPKVSEGEIVEIYTYMVRARVIDSWLLKLQR
MGKVALHAPNKGQEAVAVGAAKPLRRDDWVFPSYRELGAYLVRGMSEEEILDRALANADD
PLKGSDFAIFGNRKYNLVPAPVPVGNQIPISVGAAYAMKYLGRDTVTLTFFGDGATSRGD
FHAGLNFAGVFKVPAVLVIQNNQWAISVPRARQTAAPSLAVKGLAYGVPGVRIDGNDVMV
VYKIVSDAAEKARRGGGPTLIEAVTYRLGPHTTADDPSRYRTSEEERIMERYEPLRRMRK
FMESMGILTEKEALSIEEEWNSKVEEIVRKVLAKPPLPENVFFQNVYGEKPWFIQEEERD
LEETLKTMEELGLSYKE
NT seq 1134 nt   +upstreamnt  +downstreamnt
gtggaggagtataagactctcctcgaagatgctctggggtttaagagggcagtcgacgag
gagggcagggtagtcgacgaggaacttcttcccaaggtcagcgagggggagattgtagag
atatacacctacatggtcagggcgagagttatcgacagttggcttctgaagctgcagagg
atgggtaaggttgcgctacacgccccaaacaaggggcaggaggccgttgcagtgggcgcc
gcgaagcctttgaggagagatgactgggtgttccccagctatagagagctcggcgcctac
ctggtcaggggtatgagcgaggaggaaattctcgacagggctctggcgaacgctgacgac
cctctgaagggaagcgacttcgccatattcggaaacaggaagtataacctggtgccagcc
cccgtccctgtgggcaaccagatccccatctcggtgggcgccgcgtacgcgatgaagtac
ctgggcagggatacggttaccctcacattcttcggcgacggcgccaccagcaggggcgac
ttccacgccgggctaaacttcgctggcgtgttcaaggttccagcggttttagtgatacag
aacaaccagtgggctataagcgttcccagggcgagacagactgccgcaccctcactggct
gttaagggtcttgcatatggggttccgggcgttaggatagatggcaacgatgtaatggtg
gtgtacaagattgtcagcgatgcggcggagaaggctaggagaggcggtggaccaaccttg
atagaggctgtgacatacaggcttggcccacacacaacggccgacgacccctcaaggtac
aggactagtgaggaagagagaattatggagaggtatgaacccctgaggaggatgaggaag
ttcatggagagcatgggtatattgaccgagaaggaggccctcagcatagaggaggagtgg
aatagcaaggttgaagagatagtgaggaaggtgctggcgaagcccccgctgccggagaac
gtgttcttccagaacgtatacggggagaagccctggttcatccaggaggaggagcgggat
ctggaggagacgctcaaaactatggaggagctgggcctgagctataaggagtag

DBGET integrated database retrieval system