KEGG   Aeropyrum pernix: APE_1713
Entry
APE_1713          CDS       T00023                                 
Symbol
gltA
Name
(GenBank) citrate synthase
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
ape  Aeropyrum pernix
Pathway
ape00020  Citrate cycle (TCA cycle)
ape00630  Glyoxylate and dicarboxylate metabolism
ape01100  Metabolic pathways
ape01110  Biosynthesis of secondary metabolites
ape01120  Microbial metabolism in diverse environments
ape01200  Carbon metabolism
ape01210  2-Oxocarboxylic acid metabolism
ape01230  Biosynthesis of amino acids
Module
ape_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ape_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ape00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    APE_1713 (gltA)
   00630 Glyoxylate and dicarboxylate metabolism
    APE_1713 (gltA)
Enzymes [BR:ape01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     APE_1713 (gltA)
SSDB
Motif
Pfam: Citrate_synt
Other DBs
NCBI-ProteinID: BAA80714
UniProt: Q9YB84
Position
1079589..1080773
AA seq 394 aa
MSQQPECRVEGNYIIVPKGLVNVIVDETRISGVDPKGEATIYRGYTIEDIGEHASFYEAA
HLILFGRLPCDEELKEIKSKIDKYRGQIPEKLFDAMKHVPVTHPMYYGIYGTALLGQYYA
PEWRFDEDFLYDHALRLTAQLPVIFTTGWNLAHHGTFLRPDPSKDHAWDVLRMIVMREPS
DIEARAFESTLVLYMDHGFNASTFTTRVIGSTLSDLYSAVAGGIAALKGPLHGGANEKAM
EMFLDAMKKAEEKGVPLYDYIEEYIKEKLARKEKIMGFGHRIYKLHDPRTDVAAKFVAKL
KDGEFWMKVLKKAEEVMWREKKIPANIDLYTAVLYYQLGIPIPMYTPIFAMGRVVGWSAH
YIEQVLNNKLIRPTEKYVGPTGLKYQPIEERCRK
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgagccagcagccagagtgcagggtagagggtaactatataatcgttcctaagggcctg
gttaacgttatcgtcgacgagactagaataagcggcgttgaccccaagggcgaggcgact
atatacaggggctacactatcgaggatatcggcgagcacgccagcttctacgaagcagcc
cacctaatactattcggcaggctcccctgcgacgaggagcttaaagagataaagtcgaag
attgacaagtacaggggccagattccagagaaactgttcgacgctatgaagcacgtccca
gtaacccacccaatgtactatggaatatatggcacagccctcctcggccagtactacgcg
cctgagtggaggttcgacgaggacttcctgtacgaccatgcactcaggcttacagcacag
ctgcccgtaatctttacaacgggctggaaccttgctcaccacggcaccttcctcaggcct
gatcccagcaaggaccatgcctgggacgtgctcagaatgatagtaatgagggagccgagc
gatattgaggctagagccttcgagtcaaccctggtactctacatggaccacggattcaac
gcctcaacattcaccacaagggtcataggcagcacgctcagcgacctatacagcgcagta
gccggggggatagcggccctcaaaggccccctccacggaggcgccaacgagaaggccatg
gagatgttcctagacgctatgaagaaggctgaggagaagggcgtcccactatacgactac
attgaggagtacattaaagagaagcttgccaggaaagagaagataatgggcttcggccac
aggatctacaagctccacgaccccaggactgatgttgcggcaaagttcgtcgccaagcta
aaagacggggagttctggatgaaggtactgaagaaggccgaggaggttatgtggagggag
aagaagatacctgccaacatagacctctacactgcagtcctctactaccagctgggcata
cctatacccatgtacacgcccatattcgccatgggcagagtcgtcggatggagcgcacac
tacatagaacaggtgctaaacaacaagctgataaggcccacggagaagtacgtcggccca
acaggcctcaagtaccagccaatagaggaaagatgcaggaaatag

DBGET integrated database retrieval system