KEGG   Aeropyrum pernix: APE_1820
Entry
APE_1820          CDS       T00023                                 

Definition
(GenBank) putative oxidoreductase
Organism
ape  Aeropyrum pernix
SSDB
Motif
Pfam: FAD_oxidored DAO NAD_binding_8 FAD_binding_2 FAD_binding_3 GIDA Pyr_redox_2 Thi4 Pyr_redox HI0933_like Amino_oxidase Lycopene_cycl
Other DBs
NCBI-ProteinID: BAA80823
UniProt: Q9YAX5
Position
complement(1147657..1149069)
AA seq 470 aa
MPRYDVVVVGGGHNGLVAALTLALHGIRVALVEARDQLGGLSSDGLSLGVRYPRVAYALG
LFPEDLARFLGIDLKNYTVLTDPSWVVVDSLSGETVFRWWLSRDALRREFVEKGLPESEA
GMFVGLLESWRRCSGEIIFSIRPPSLEEASERLRRCGGEQLASAFYERFDKTLGRLLPRE
LWGLLTYPGYESEPGATSLLHLWNGGVWMQLPRGWAPLLLDLEEKAREHGVDVFRGLGPA
VIRVKAGRVQGVEVGGKVLEAGRVVYSGSIVALPNALGDSRDVLGREVLSELDKISKTSI
IADRVNVLTSCRPEPPYRAGGRPPLVEVWGRGYWFEAAYPTLHPEGLDELSGRHVVALTG
LFDGAEAQEILSRAGVGCVDKVESIDRHVLAMEFLNPSGNPNHIPLNGGRILDKRPFEGW
SDYTTPISGLYHGSASSHPGGQVSGVPGHNAAVRLLVDAGVKPRSPLARL
NT seq 1413 nt   +upstreamnt  +downstreamnt
gtgccacgctatgatgttgtggtagttggtggtggccacaatggtttggttgccgcatta
acgcttgccctccacggtattcgtgtggctctggttgaggctcgcgaccagctggggggc
ctttcttccgacggcctgtccttgggtgttagataccctcgggttgcttacgcgttaggc
cttttccccgaggaccttgcacgttttctgggtatagatttgaagaactataccgtgctc
accgatccctcctgggttgtggtggactccctctctggtgagactgttttcaggtggtgg
ttaagccgtgatgcgcttaggagggagttcgtggagaaggggttgcccgagtctgaggca
ggtatgtttgtgggcctcctcgaatcctggagacggtgtagcggcgagataatattctct
ataaggccgcccagccttgaggaggcttctgagaggctgaggcgatgcggaggtgaacag
ctggcgagcgcattctacgagaggttcgacaagaccctggggaggcttcttcccagggag
ctctgggggctgctcacatatcctggctacgagtctgagccgggggcaacatccctcctc
cacctgtggaacgggggtgtgtggatgcagctcccaaggggttgggcccctctacttctt
gacttggaagagaaggctcgagagcacggggtggacgtgtttaggggtctagggcctgcg
gtgataagggttaaggctggcagggtgcagggagtcgaggttggtgggaaggttctagag
gcgggaagggtagtgtactctgggagtatagtcgcgctgccgaacgcgttgggagactct
cgggacgtgcttggcagggaggtcctcagcgagctggataagatctccaaaacctctatt
atagccgacagggttaatgttttgaccagctgcaggcccgaaccaccgtaccgggctggc
ggtaggccgccgctcgtggaggtgtggggaaggggttactggtttgaggctgcatacccg
acgctgcatccagaaggcctggacgagctgtccgggaggcatgttgtggcgcttacaggc
cttttcgacggcgcggaagcgcaggagatactgagcagggcgggtgtgggctgcgtagat
aaggttgagagcatagacaggcatgtgcttgccatggagtttctaaacccgtcgggcaac
cccaatcacatccccctaaacggcggcagaatactcgataagaggcctttcgaaggctgg
tccgactatactacacctattagtgggttgtaccacggctcggcctccagccacccggga
ggtcaggtgtcaggcgtgcctggccataacgctgccgtacgcctgctagttgatgctgga
gtcaagcctaggagcccgcttgcaaggctatag

DBGET integrated database retrieval system