KEGG   Aeropyrum pernix: APE_1885
Entry
APE_1885          CDS       T00023                                 

Definition
(GenBank) 5'-methylthioadenosine phosphorylase
  KO
K00772  5'-methylthioadenosine phosphorylase [EC:2.4.2.28]
Organism
ape  Aeropyrum pernix
Pathway
ape00270  Cysteine and methionine metabolism
ape01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ape00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    APE_1885
Enzymes [BR:ape01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.28  S-methyl-5'-thioadenosine phosphorylase
     APE_1885
SSDB
Motif
Pfam: PNP_UDP_1
Other DBs
NCBI-ProteinID: BAA80890
UniProt: Q9YAQ8
Structure
PDB: 
1WTA

Position
1194314..1195141
AA seq 275 aa
MFEITRPPGVRAHVGVIGGSGLYDPGIVENPVEVKVSTPYGNPSDFIVVGDVAGVKVAFL
PRHGRGHRIPPHAINYRANIWALKALGVKWVISVSAVGSLREDYRPGDFVVPDQFIDMTK
NRRHYTFYDGPVTVHVSMADPFCEDLRQRLIDSGRRLGYTVHERGTYVCIEGPRFSTRAE
SRVWKDVFKADIIGMTLVPEINLACEAQLCYATLAMVTDYDVWADRPVTAEEVERVMISN
VERARRMLYDVIPKLAGEPELERCSCCRALDTAAI
NT seq 828 nt   +upstreamnt  +downstreamnt
gtgttcgagattacgcgccccccaggagtaagggctcatgttggtgttataggtggcagc
ggcctctacgatcctggcattgtagagaaccccgttgaggttaaggtttccacgccttac
ggtaacccgagcgactttatagtagtgggggatgtagccggggtcaaggtcgccttcctc
cccaggcacggtagggggcacaggatcccgcctcacgccataaactatagggccaacata
tgggcgctcaaggcgcttggggtgaagtgggttatcagcgtcagcgcggtaggaagtttg
agggaggactataggccgggcgatttcgtcgttcccgaccagtttatagatatgaccaag
aacaggcggcactacacattctacgacggccccgtgactgttcacgtcagcatggccgac
cccttctgcgaggacctgaggcagaggctaatagactccggcaggaggctcggctacaca
gtgcacgagagggggacctacgtctgcatagaaggcccccgcttctcgaccagggcggag
agtagggtgtggaaggacgtgttcaaggctgacataataggtatgacgctggtcccggag
ataaacctcgcctgcgaagcccagctatgctacgccacactagctatggtgacggactat
gacgtgtgggcagacaggcccgttactgctgaggaggtggagagagtcatgataagcaat
gtcgagagggccaggaggatgctctacgacgtcataccaaagctggcgggagagccggag
ctggagaggtgcagctgctgccgtgcactcgacaccgcagcaatctag

DBGET integrated database retrieval system