KEGG   Aeropyrum pernix: APE_2075
Entry
APE_2075          CDS       T00023                                 

Definition
(GenBank) hypothetical protein
Organism
ape  Aeropyrum pernix
SSDB
Motif
Pfam: PAPS_reduct NAD_synthase Diphthami_syn_2 QueC ATP_bind_3
Other DBs
NCBI-ProteinID: BAA81086
UniProt: Q9YA63
Position
complement(1309321..1310715)
AA seq 464 aa
MLRVVARSRKDAKAAKAAVEKFMGGWGIEVESLGGPRGGALEEAILREARPFTVFLLGRE
DLDPNSMGGLQDALPPFSEVAVVKGSRVRNVRVEAIYSALNSARARIRLRTHWSGSTFIL
SRRPGSVEVEDLPYSPQGDSFFVYGRGSKVLGLFMQRSIGGAALLFKMYGGKHLVYSGPR
PLGELVIDNSKPLPQGRLYRRVKPVRVDVESLVEANRSILRVLEQHSAEVLRMVGEDVDT
VIVPWSGGKDSTAALLLAVEAFGRDAVKAVYVDTGIDFIENAEYVEKVASTLGVDLVYAR
ADVDEGLLIEGMPMPDPEYRWCTGRKLEALRQAFRTVSRGKTVVVTGDRDGESEKRGKRP
PLRYDEKLGYPVVSPLKLWSGGHVQLYILSKGIPLNPLYEAGFYRIGCYLCFALRSWEIE
VMKRGGIIERILRERPGHRELVEKFLELKKKGFGGDLGACICGV
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgctaagggtagtggcgaggagtaggaaggacgctaaggctgccaaggctgccgtcgag
aagttcatgggaggatggggtatagaggtcgagagcctcggcggccccaggggcggtgcc
ctagaggaggctatactgagggaggccaggccgttcactgtattcctcctgggcagggag
gacctcgaccccaatagtatggggggtttacaagacgcgctcccccccttctccgaggta
gcggtggttaaggggtcgagggttaggaacgttagggtagaagctatatactcagccctc
aacagcgccagagccaggatcaggcttaggacgcactggagcggctccaccttcatactc
tctcgccggcctggcagcgttgaagtagaggatcttccctacagccctcagggcgacagc
ttcttcgtctacgggaggggctctaaggttctaggcttgttcatgcagaggagtatagga
ggcgccgcgctgctgttcaaaatgtatggtggaaagcacctggtgtacagcgggccgagg
cccctgggcgagctagtgatagacaattctaagccgctcccccagggcaggctctacaga
cgtgttaagcctgtccgcgtcgatgtagaaagcctagtagaggctaacaggagtattctg
agggtattggagcagcattccgctgaggtcctgaggatggtgggtgaggatgtggacacc
gtgattgtaccgtggagcggcggcaaagactctacggcagcccttctcctggcggtcgag
gctttcggcagggacgctgtcaaggcagtctacgtcgacaccgggatagactttatagag
aacgccgagtatgttgagaaggtggcttccaccctaggcgtcgatctagtttatgcgagg
gccgacgtcgacgaggggctgctaatagagggcatgcccatgccggaccccgagtacagg
tggtgcaccgggaggaagctggaggccctccggcaagccttccgaacagtctcccgaggc
aaaaccgtagtagtgactggagacagggatggagagtctgagaaaaggggcaaaagaccg
cccctcagatacgatgagaagctaggatatcctgttgtgtcgccccttaagctgtggagc
ggcggccatgtacagctctacatactatcgaagggcatacccctgaacccgctctacgag
gcagggttctacaggataggatgctacctatgctttgcgcttcgaagctgggagatagag
gttatgaagaggggcggtataatagagaggatactcagggagaggcccgggcatagggag
cttgtggagaagttccttgagttgaagaagaagggttttggaggcgacctaggggcctgc
atatgcggggtgtaa

DBGET integrated database retrieval system