KEGG   Aeropyrum pernix: APE_2098.1
Entry
APE_2098.1        CDS       T00023                                 

Definition
(GenBank) family B DNA polymerase II
  KO
K02319  DNA polymerase, archaea type [EC:2.7.7.7]
Organism
ape  Aeropyrum pernix
Pathway
ape03030  DNA replication
Brite
KEGG Orthology (KO) [BR:ape00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    APE_2098.1
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ape03032]
    APE_2098.1
Enzymes [BR:ape01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     APE_2098.1
DNA replication proteins [BR:ape03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (archaeal)
    B-family DNA polymerases
     APE_2098.1
SSDB
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 RNase_H_2 DNA_pol_B_exo2 DNA_pol_B_2
Other DBs
NCBI-ProteinID: BAA81109
UniProt: O93746
Position
complement(1324752..1327163)
AA seq 803 aa
MKGSDATLLSFQLLDVSYEMRGSTPVIILWGRGADGSRVVVFYGEFRPYFYVLPDGSVGL
DQLAAMIRRLSRPSSPILSVERVRRRFIGREVEALKVTTLVPASVREYREAVRRLGGVRD
VLEADIPFALRFIIDFNLYPMRWYVAEVREVAVPHGYSVDRAYTLSGDIREDETRIQEDP
LKGLRVMAFDIEVYSKMRTPDPKKDPVIMIGLQQAGGEIEILEAEDRSDKKVIAGFVERV
KSIDPDVIVGYNQNRFDWPYLVERARVLGVKLAVGRRSVEPQPGLYGHYSVSGRLNVDLL
DFAEELHEVKVKTLEEVADYLGVVKIGERVTLEWWQIGEYWDDPSKREILRKYLRDDVRS
TMGLAEKFLPFGAELSQVSGLPLDQVMAASVGFRLEWRLIREAAKLGELVPNRVERSEGR
YAGAIVLRPKPGVHEDIAVLDFASMYPNIMVKYNVGPDTLVRPGEEYGEEEVYTAPEVGH
KFRKSPPGFFKKILERFLSWRRQIRSEMKKHPPDSPEYKLLDERQKAIKLLANASYGYMG
WPHARWYCRECAEAVTAWGRSIIRTAIRKAGELGLEVIYGDTDSLFVKNDPEKVERLIRF
VEEELGFDIKVDKVYRRVFFTEAKKRYVGLTVDGKIDVVGFEAVRGDWSELAKETQFKVA
EIVLKTGSVDEAVDYVRNIIEKLRRGQVDMRKLVIWKTLTRPPSMYEARQPHVTAALLME
RAGIKVEPGAKIGYVVTKGSGPLYTRAKPYFMASKEEVDVEYYVDKQVVPAALRILQYFG
VTEKRLKGGGRQSTLLDFMRRGK
NT seq 2412 nt   +upstreamnt  +downstreamnt
ttgaagggttccgacgctacactcctctcctttcaactcctagacgtctcgtacgagatg
agggggtcaacccccgttatcatactctgggggcggggggctgacgggtctagggttgtc
gtgttctacggcgagttcagaccctacttctacgtgctgcccgacgggagcgtaggcctc
gaccagctggcagctatgataaggaggctctcaaggccgtccagcccaatactctcggtt
gagagggttcgacgcaggtttataggcagggaggtggaggctctcaaggtaaccaccctc
gtccccgcaagcgtcagggagtatagggaggctgtgcgtaggctggggggcgttagggat
gtcctggaggccgatatacccttcgccctcaggttcatcatagactttaacctataccct
atgagatggtatgtggccgaggttagggaggtcgcggtcccccacggctatagcgttgac
agggcctacacgctctccggcgatataagggaggacgagacgaggatccaggaggacccc
ctgaagggcctcagggttatggctttcgacatagaggtctacagcaagatgaggacgcca
gaccccaagaaggacccggtaatcatgatagggttgcagcaggccggaggggagatcgag
atcctggaggcggaggataggagtgacaagaaggttatagccggcttcgtcgagcgcgtg
aagagtatcgaccctgacgtgatagtcggctataaccagaacaggttcgactggccatac
ctggttgagagggccagagttctcggcgtgaagcttgcggtcgggaggaggagcgtggaa
ccccagcccggcttgtacgggcactactccgtctctggcaggctcaacgtagacctccta
gactttgcggaggagctccacgaggttaaggttaagactctcgaggaagtcgcggactac
ctaggggtcgtgaagataggggagagggttactctagagtggtggcagataggggagtac
tgggatgacccgtcaaagcgggagatactcaggaagtacctaagggacgatgtcagaagc
accatggggctggcagagaagttcctacccttcggggcggagctctcacaagtctcaggg
ctccccctggaccaggttatggcggccagcgtaggcttcagactggagtggaggctcata
cgggaggcggctaagctcggcgagctggtgcccaacagggttgagaggagcgagggcaga
tacgctggggccatagtactcaggcccaagccgggggttcacgaggatattgccgtcctg
gacttcgcaagcatgtacccgaatatcatggtaaagtataacgtcggccccgacactctg
gtcaggcctggggaggagtatggagaggaggaggtatacacggctccggaggtgggccac
aagttcaggaagagccctcccggcttcttcaagaaaatacttgagaggttcctaagctgg
aggaggcagattaggagcgagatgaagaagcatccgcccgacagcccggagtacaagctc
ctcgacgagaggcagaaggcgataaagctcctggcaaacgccagctacggctacatgggc
tggccccatgccaggtggtactgtagagagtgtgcagaggcggttacagcgtggggtagg
agcataataaggactgctataaggaaggctggcgagctagggctggaggttatatatgga
gacacggacagcctcttcgtcaagaacgatcctgagaaggtggaaaggctgataaggttt
gtcgaggaggagcttgggttcgacattaaggtggacaaggtgtacaggcgtgtattcttc
accgaggccaagaagaggtatgtggggctgacggtggacggcaagatagatgtagtcggc
ttcgaagctgtcaggggcgactggagcgagctcgcgaaggagacgcagttcaaggtggca
gagatagtcttaaagaccggtagcgtggacgaggctgtcgactacgtcaggaatataata
gagaagcttaggaggggccaggtggacatgaggaaactggtcatttggaagactctgaca
cggcctccatcaatgtacgaggcgaggcagccccacgtgaccgcagcgctacttatggag
agggctggcataaaggtcgagccaggggctaagatcggctacgtggtgaccaaggggtca
ggccccctctatacgagggcgaagccttattttatggctagcaaggaggaggttgacgtg
gagtactatgtcgacaagcaggtggtgccagcggctctgcgcatactccagtacttcgga
gtaactgagaagaggctgaagggaggaggaaggcagagcacgctcctcgacttcatgagg
cgggggaaataa

DBGET integrated database retrieval system