KEGG   Aeropyrum pernix: APE_2104.1
Entry
APE_2104.1        CDS       T00023                                 
Name
(GenBank) endonuclease IV
  KO
K01151  deoxyribonuclease IV [EC:3.1.21.2]
Organism
ape  Aeropyrum pernix
Pathway
ape03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ape00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    APE_2104.1
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ape03400]
    APE_2104.1
Enzymes [BR:ape01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.2  deoxyribonuclease IV
     APE_2104.1
DNA repair and recombination proteins [BR:ape03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     APE_2104.1
SSDB
Motif
Pfam: AP_endonuc_2 UvdE
Other DBs
NCBI-ProteinID: BAA81115
UniProt: Q9YA35
Position
complement(1327612..1328454)
AA seq 280 aa
MGVIRFGPAGKPVEFKGDIVKVPEFLRSIGLDALEYEAVRGVRISEAKARRLGEAARENG
VILSMHAPYYVNLSSPDDSVVERSIKRLYDSMIASEWMGSYAVVVHPGYYKGLKSREEAV
KRVIEALNRLIESLPSWVKTPWIAPETMGKQSQVGSLEETVEICLNTPRCRPCVDWAHLY
ARAEGKFVTSVDQVVKAIEYIESNLGREAVDPLHTHFSKIEYGKGGERMHHTLREEGYGP
DWRIVCRAYKETGINAVVISESPILEKDALLMKSICKGEA
NT seq 843 nt   +upstreamnt  +downstreamnt
ttgggtgtcatacgtttcggcccggcaggcaagcctgtggagtttaagggtgacatagtg
aaggttccagagttcctcaggagtattggcctagacgcgcttgagtatgaggctgtgagg
ggcgtcaggataagcgaggctaaggcaagacgcttgggggaggcggcgagggagaacggt
gttatactaagcatgcacgccccctactatgtcaacctctccagccccgacgacagcgtc
gtggagaggagtataaagaggctttacgactcgatgatcgcgtccgaatggatgggcagt
tacgcagtggtcgtccacccaggctactataagggtcttaagagcagggaggaggctgta
aagagggttatagaagcgctgaacaggctaatcgagtccctgccaagctgggtgaagaca
ccatggatagcccccgagaccatgggaaagcagagccaggtcggtagcctggaggagacc
gtggagatatgcctcaacacccccaggtgcaggccatgcgttgactgggcccacctctac
gcgagggctgagggaaagttcgtcacgagcgtcgaccaggtggtgaaggcaatagaatat
atagagtcgaacctaggcagggaggctgtagaccccctccacacccacttctccaagata
gagtatgggaaggggggagagaggatgcaccacacactccgggaggaaggctacggcccc
gactggaggattgtatgcagggcttacaaggagacgggtataaacgccgttgtcataagc
gaaagcccgatactggagaaggacgccctcctcatgaagtccatatgcaagggtgaggca
tga

DBGET integrated database retrieval system