KEGG   Aeropyrum pernix: APE_2247
Entry
APE_2247          CDS       T00023                                 
Name
(GenBank) 3-methyladenine DNA glycosylase
  KO
K03652  DNA-3-methyladenine glycosylase [EC:3.2.2.21]
Organism
ape  Aeropyrum pernix
Pathway
ape03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ape00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    APE_2247
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ape03400]
    APE_2247
Enzymes [BR:ape01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.21  DNA-3-methyladenine glycosylase II
     APE_2247
DNA repair and recombination proteins [BR:ape03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     APE_2247
 Prokaryotic type
     APE_2247
SSDB
Motif
Pfam: Pur_DNA_glyco
Other DBs
NCBI-ProteinID: BAA81259
UniProt: Q9Y9P1
Position
complement(1423537..1424121)
AA seq 194 aa
MGRLLPKSFYYRQPDVVARELLGKILVSCASGACMRCMVTEAEAYFGECDPASRARRGRG
RIWRALYGEPGRALVYGMHRQWLLNIVAHSEGMAGAVLLRSCQPLEPPRLDPPPIGPGRL
ARALSIDRGVDGAPVYERGSPLTLWENPEAVEGFRVACSGRVGVSEDLELPLRFYIAGNP
FVSKARVSPAPKHC
NT seq 585 nt   +upstreamnt  +downstreamnt
gtgggtaggcttctacccaagagtttttactatagacagcccgacgttgtggctagagag
ctgttgggcaaaatcctcgtctcctgcgccagcggagcatgtatgaggtgcatggttacc
gaggctgaggcctacttcggcgagtgcgaccccgcctccagggccaggagggggagggga
aggatatggagggccctctatggggagcccgggagagccctggtctatggtatgcatagg
cagtggctactcaacatagtcgcacacagcgagggtatggctggggcggtgctgctgagg
tcctgccagcccctcgagccgccccgcctagacccccctcccatagggcctgggaggcta
gccagagccctgtccatagataggggtgtggacggggctccggtttacgagcggggctcg
cccttgacgctctgggagaaccctgaagctgtagagggcttccgcgtagcgtgttccggg
cgcgtcggcgtctccgaggacctcgagctcccgctcaggttctacatagccgggaacccg
ttcgtctccaaagcccgagtctcgccagcccctaaacactgctag

DBGET integrated database retrieval system