KEGG   Aeropyrum pernix: APE_2296
Entry
APE_2296          CDS       T00023                                 

Gene name
hemA
Definition
(GenBank) glutamyl-tRNA reductase
  KO
K02492  glutamyl-tRNA reductase [EC:1.2.1.70]
Organism
ape  Aeropyrum pernix
Pathway
ape00860  Porphyrin and chlorophyll metabolism
ape01100  Metabolic pathways
ape01110  Biosynthesis of secondary metabolites
ape01120  Microbial metabolism in diverse environments
ape01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:ape00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    APE_2296 (hemA)
Enzymes [BR:ape01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.70  glutamyl-tRNA reductase
     APE_2296 (hemA)
SSDB
Motif
Pfam: GlutR_N Shikimate_DH GlutR_dimer DAO GFO_IDH_MocA CHAD ParA
Other DBs
NCBI-ProteinID: BAA81308
UniProt: Q9Y9J2
Position
complement(1468931..1470181)
AA seq 416 aa
MIDRLAMIGVNVKTASREHVARLEKEWEKHLDTIGYASRGTVIIATCNRFEVYLDSPSRL
VEDLASSIASPGGEGLVRLQGIDAARHLFRVASGLESQIIGDHEVLGQVRRAWLKSREKG
FTTPLLDEVFHRALKTGARVRSESAISSGGVGYSSAAVSLAASLLGGGLDGARVGIVGAG
MAAVGIARALCTRWRPRVVAVFNRTPERGWEVAGKCRGVESLVLPLDELAKLINELDALF
VAIAGSTNILERGRVERGVSPRVIVDISNPPVTPKVAGRVFHMPEVEEEAKRMMEERLRW
IPAAEAIIEEELEALLDALSRRRARESSRSVMRALSILAEREYERTLAGLRNGVDPREAV
ELALNSYTKKVGGALRRLLEEASDRGQLSLEDIEAILVSEFARIAENSGFKNGSTG
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgatagacaggctcgccatgataggggtaaacgttaaaaccgcctccagggagcacgtg
gccaggcttgagaaagagtgggagaaacacctagacactataggttatgcatcgagagga
accgtcataatagcaacgtgcaacaggttcgaggtctatctagacagcccatccaggcta
gtggaggacctcgcctccagcatagcctcccccggtggagaaggcctagtaaggctacaa
ggtatcgatgccgccagacacctcttcagagtggcctcgggcctcgagtcccagataata
ggggatcacgaggtcctcgggcaggtacgcagagcctggcttaagtctagggagaagggg
ttcaccacgcctctgctcgacgaggtgttccacagggccctcaagactggggccagggtt
agaagcgagtcggccatatcgtcgggtggagtggggtactccagcgcggcggtgtcccta
gctgccagcctcctaggaggtgggcttgacggggcgagagttggcatagtgggggcgggc
atggctgccgtaggcatagccagagcattgtgcaccaggtggaggccgagagttgtagcg
gtgtttaacaggacccctgagaggggttgggaggtcgctggcaagtgcaggggcgtggag
tccctagtattaccgcttgacgagctggcgaagcttataaatgaattagacgccctcttc
gtcgccatagcaggctctaccaatattctggagagggggagggttgagaggggcgtgagc
cccagggttatagtagacatctcaaacccgccggttaccccaaaggtggcgggcagggtt
ttccacatgcccgaggttgaggaggaggctaagaggatgatggaggagaggctgcgttgg
atacctgccgccgaggcgataatagaggaggagctggaggccctgctggatgccctctct
aggagaagggctagagagtcttcgagatccgtcatgagggccctctccatactcgccgag
agggagtatgagagaacgcttgccggccttaggaacggcgtagacccccgcgaggccgtg
gagctcgcgctcaactcctacacaaaaaaggtggggggcgcgttgagaaggcttctcgag
gaggctagtgacaggggtcaactgtccctggaggacatagaggctatactagtcagcgag
ttcgccaggatagccgagaactccgggtttaaaaacggtagcaccgggtga

DBGET integrated database retrieval system