KEGG   Aeropyrum pernix: APE_2299.1Help
Entry
APE_2299.1        CDS       T00023                                 

Gene name
hemL
Definition
(GenBank) glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
ape  Aeropyrum pernix
Pathway
ape00860  Porphyrin and chlorophyll metabolism
ape01100  Metabolic pathways
ape01110  Biosynthesis of secondary metabolites
ape01120  Microbial metabolism in diverse environments
Module
ape_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:ape00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    APE_2299.1 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ape01007]
    APE_2299.1 (hemL)
Enzymes [BR:ape01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     APE_2299.1 (hemL)
Amino acid related enzymes [BR:ape01007]
 Aminotransferase (transaminase)
  Class III
   APE_2299.1 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: BAA81311
UniProt: Q9Y9I9
Structure
PDB: 

Position
complement(1471101..1472390)
Genome map
AA seq 429 aa AA seqDB search
MASGEKSRMLFERTKELFPGGVNSPVRAAVKPYPFYVKRGEGAYLYTVDGARIVDLVLAY
GPLILGHKHPRVLEAVEEALARGWLYGAPGEAEVLLAEKILGYVKRGGMIRFVNSGTEAT
MTAIRLARGYTGRDLILKFDGCYHGSHDAVLVAAGSAAAHYGVPTSAGVPEAVARLTLVT
PYNDVEALERVFAEYGDRIAGVIVEPVIANAGVIPPRREFLAALQRLSRESGALLILDEV
VTGFRLGLEGAQGYFNIEGDIIVLGKIIGGGFPVGAVAGSREVMSLLTPQGKVFNAGTFN
AHPITMAAGLATLKALEEEPVYSVSREAAKALEEAASEVLDRTGLPYTINRVESMMQLFI
GVEEVSNAAQARKADKKFYVKLHEEMLRRGVFIAPSNLEAVFTGLPHQGEALEIAVEGLR
SSLKTVLGS
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
ttggcatcgggcgagaagagtagaatgctcttcgagaggaccaaggagctattccctgga
ggcgtcaatagcccggttagggctgccgtcaagccctatcccttctacgtgaagaggggg
gaaggcgcttacttatacaccgtagacggcgccaggatcgttgacctggtgctagcctac
ggccccctcatactaggccataagcaccctagggttttagaggcggttgaggaggcccta
gcccgggggtggctgtacggggcgcccggcgaagccgaggtcctcctggcagagaagata
ctgggctatgttaagagggggggtatgataaggtttgtcaattcaggtacagaggccaca
atgacggccataaggcttgctagagggtacactgggagagacctcatactgaagttcgac
gggtgctaccacggtagccacgacgctgtgctcgttgcagctgggagcgcggctgcacac
tacggcgtccctaccagcgcgggggtccctgaggctgtcgccaggctaaccctcgtcacc
ccgtataacgatgtcgaggctctcgaacgcgtcttcgccgagtatggagacaggatagcg
ggagtcatagtagagcccgttatagctaatgctggggttatacctccccgcagggagttc
ctagcggccctccagaggctttccagagagagtggggcgcttctgatcctggatgaagtg
gtcacagggttcaggctcggtctcgaaggggctcaaggctacttcaacattgaaggcgac
ataattgttctgggcaagataataggcggcggcttcccggtcggcgctgtagcagggtct
agggaggtgatgagcctcctaacaccccagggcaaggtgttcaacgcgggaacgttcaac
gcgcaccccataaccatggctgccgggctggccacgctgaaggctctcgaggaggagccg
gtctacagtgtttcgagggaggcggcaaaggctctcgaggaggcggcatccgaggtcctc
gacaggacgggcttaccctacactataaacagggtggagagcatgatgcagcttttcata
ggagtcgaggaggtttccaacgctgcccaggcgagaaaagctgataagaagttctacgtc
aagctccacgaagagatgctcaggaggggcgtattcatagctccctcgaacctggaggca
gtattcacaggcctcccacaccagggtgaggccctagagattgcggttgagggcctcagg
agttcgctcaagacggtgctggggtcttga

DBGET integrated database retrieval system