KEGG   Aeropyrum pernix: APE_2550Help
Entry
APE_2550          CDS       T00023                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ape  Aeropyrum pernix
Pathway
ape00260  Glycine, serine and threonine metabolism
ape00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ape01100  Metabolic pathways
ape01110  Biosynthesis of secondary metabolites
ape01130  Biosynthesis of antibiotics
ape01230  Biosynthesis of amino acids
Module
ape_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ape00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    APE_2550 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    APE_2550 (trpA)
Enzymes [BR:ape01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     APE_2550 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA NanE PcrB TMP-TENI His_biosynth ThiG FMN_dh Ribul_P_3_epim DHO_dh
Motif
Other DBs
NCBI-ProteinID: BAA81567
UniProt: Q9Y8T3
Position
complement(1622072..1622830)
Genome map
AA seq 252 aa AA seqDB search
MAIARPGFSVYLTIAWPSPDTFLEIASTLKGCVDYLELGIPTPKPLYDGPTIRLTHLKAV
ESGYSGPKTLSLAEEASQEAGVPYIVMAYATEQPWSFSEVLREASRKGALSVLPPDLPFE
LPGHVEWYVEESRRLGMEPSLFASPKFPHRWLDRYRRLDPLLIYLGLQPATGVKLPLAFL
RNVKTARKIVGQVYMLAGFSIKSPEDALRVLEAGADAVVVGSEVARLVSSGRLGEARHLA
CSIRAAISERGG
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggctatagctaggcccggcttttcagtgtacctcacaatagcctggcctagccccgac
acgttcctcgagatcgcctcgaccctgaaaggttgtgtagactatctggagctaggaata
cccacgcccaagccgctctacgacgggcctaccataaggctcacacacctcaaagcagtc
gagtccggctactcagggccaaaaaccctcagcctagccgaggaggcttctcaagaggcc
ggagtcccatatatagtgatggcctacgccaccgaacagccgtggagcttcagcgaagta
ctgagggaagcttccagaaaaggggcattaagcgttctccctccggacctccccttcgag
ctgcctggccatgtggaatggtacgttgaggagtctaggcggctcggcatggaaccgagt
ctcttcgcctcacccaaattcccacaccgctggctagacaggtataggagactggaccct
ctcctcatatacctgggccttcagccagctacaggggtgaagctgccactagcctttctg
cgcaacgtgaagactgctaggaagatagttgggcaggtgtacatgctagccggcttcagc
atcaaaagccctgaagacgctctaagggtcctagaggcgggtgcagacgccgtcgttgtg
ggatcagaagttgcacgcctagtctcgtccggcaggctaggggaggctcgccacttagcc
tgtagcatacgcgcagccataagtgagagaggtggctag

DBGET integrated database retrieval system