KEGG   Aeropyrum pernix: APE_2605.1
Entry
APE_2605.1        CDS       T00023                                 

Definition
(GenBank) molybdopterin oxidoreductase, iron-sulfur binding subunit
Organism
ape  Aeropyrum pernix
SSDB
Motif
Pfam: Fer4_11 Fer4_7 Fer4_9 Fer4_6 Fer4 Fer4_10 Fer4_2 Fer4_3 Fer4_21 Fer4_17 Fer4_16 Fer4_15 Fer4_8 Fer4_4 Fer4_13
Other DBs
NCBI-ProteinID: BAA81623
UniProt: Q9Y8M7
Position
1658356..1659057
AA seq 233 aa
MKRSPSTACSTCNTRREFLKKTAKAAVATSSLILLGSVTIKSQAASERVRGRRFAMFIDV
DKCYGCYACVVACAHENNVPIGVYRTWIERYVKEDGTPVYVPKQCNHCDNPSCVDVCPVK
ATYVNEDGIVLVDDDLCIGCGACIQNCPYGARFYNPIKGVADKCTFCVHRIYSDMLPACV
EACPTGARVFGELADEESEVSKLIRSNNVQQLKPWTGNDPQIFYKDLPQEANT
NT seq 702 nt   +upstreamnt  +downstreamnt
atgaagcgttccccttcaacagcatgtagcacgtgcaacacgaggagagagttcctgaag
aagacggcaaaagcggcagtggcaacgtcatccctcatactgctaggatccgtcacaata
aagtctcaggcagccagcgagagggtaagaggcagacgctttgcgatgtttatcgacgtc
gacaagtgctacggctgctacgcgtgtgtcgttgcctgtgcccacgagaacaatgtgcct
ataggagtatataggacttggatagaaaggtatgtgaaggaggacggtactcccgtttat
gtccccaaacagtgcaaccactgtgataacccgtcctgtgttgatgtctgtcctgtaaag
gcaacctacgtcaacgaggacggcattgtcctcgtggatgacgacctatgcataggctgt
ggagcatgtatacagaactgcccctacggagctaggttctacaaccccatcaaaggagtc
gcggacaagtgtaccttctgcgtccacagaatatactccgacatgcttcccgcctgtgta
gaggcctgtccgacgggtgcaagggtgttcggcgagcttgccgacgaggaaagcgaggtc
tcgaagctcataaggagcaacaatgtccagcagctcaagccatggaccggcaacgaccca
cagatattctacaaggacttgccccaggaggctaacacctag

DBGET integrated database retrieval system