KEGG   Acetobacter persici: A0U91_03575Help
Entry
A0U91_03575       CDS       T04751                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
aper  Acetobacter persici
Pathway
aper03010  Ribosome
Brite
KEGG Orthology (KO) [BR:aper00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    A0U91_03575
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:aper03011]
    A0U91_03575
Ribosome [BR:aper03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    A0U91_03575
  Bacteria
    A0U91_03575
  Archaea
    A0U91_03575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Gag_spuma KORA Jag_N
Motif
Other DBs
NCBI-ProteinID: AQT04229
UniProt: A0A1U9LCW1
Position
complement(786685..787095)
Genome map
AA seq 136 aa AA seqDB search
MSKPKHPRTLAETEAQAITRNIRVSPRKLNLVAGLIRNKPASQAVATLTFSKRRIAQEVK
KTLESAIANAENNHQLDVDQLVVKTAEVGKSIVMRRFHARGRGRSARVEKFFSHLKIVVA
ERAPQPEAASPEQKAA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagccgaagcatccgcgcacgctcgcggaaacagaagcgcaggcgatcacgcgc
aacatccgggttagtccccgcaagttgaaccttgttgccggtctgatccgcaacaagccc
gcgtctcaggctgttgcaaccctgacgttctccaagcgtcgcattgcccaggaagtcaaa
aagactctggaaagcgcgattgcaaatgctgagaacaatcaccagctggacgttgaccag
ctggttgtgaagacggctgaggtcgggaagtccattgtcatgcgtcgcttccatgcgcgt
ggccgtggtcgttccgcccgtgtggaaaaattcttcagccatctgaagattgttgttgca
gaacgggctccgcagcccgaagcagcttctcctgagcagaaggcagcctga

DBGET integrated database retrieval system