KEGG   Acetobacter pasteurianus IFO 3283-03: APA03_07290Help
Entry
APA03_07290       CDS       T01812                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
apf  Acetobacter pasteurianus IFO 3283-03
Pathway
apf00220  Arginine biosynthesis
apf01100  Metabolic pathways
apf01110  Biosynthesis of secondary metabolites
apf01130  Biosynthesis of antibiotics
apf01230  Biosynthesis of amino acids
Module
apf_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:apf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    APA03_07290
Enzymes [BR:apf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     APA03_07290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: BAI01928
Position
complement(753390..754376)
Genome map
AA seq 328 aa AA seqDB search
MTTALPSSSLATPRHFLDLKDLDAATLRQILDVAASMKRMQQNRRFPLHPRQPLAGRQLG
LILSKPSTRTRVSFEVGIRQLGGDAVVLSPQEMQIGRGESIADTARVLSRFVDAIMLRTG
NTKTMHELAQWSTVPVINGLTPHSHPVQILADIMTFEEHRGPVRGRTFAWTGDGNNVLVS
LIEGAVRFGFALRAATPADMKPPQDVLDWARAEGGDVEWTVDPKAAAKGADCVVTDTWIS
MSDSPKEAATRMSKLEPYRVNADLMALAAPDALFMHCLPAHIGEEVTKDVFEGPHSVVFD
EAENRLHAQKGVLAWTMGGTNWTSFGKE
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaccactgccctgccctcttcttccttggcaacgccccgccattttctggatctgaaa
gatctggatgccgcaaccctgcgccagattctggatgtagccgccagcatgaagcgcatg
cagcagaaccgccggtttccgctacacccgcgccagccgctggccgggcggcagttgggg
cttattctttccaagccatccacccgcacccgtgtttcctttgaagtgggcattcgccag
cttgggggcgatgccgtggtgctcagcccgcaggaaatgcagattggccgtggtgagagc
attgccgatacagcccgcgtgctctcccgctttgtagatgccattatgctgcgtactggc
aacacaaaaaccatgcacgaactggcacagtggagcacggtgcccgttatcaatggcctt
accccgcattctcacccggtgcagattctggccgatatcatgacgtttgaggaacatcgt
ggccccgtgcgtggccgcacctttgcgtggacgggtgatggcaacaacgtgcttgtctcc
cttattgaaggggccgtgcgttttggctttgccctgcgtgccgccacccccgcagacatg
aagcccccgcaggatgtgctggactgggcccgtgccgaaggcggtgatgtggaatggacg
gtagacccaaaagccgccgcaaaaggtgccgattgcgtggtgacagatacatggatcagc
atgtctgattcccccaaggaagccgccacccgcatgagcaagctggaaccctaccgcgta
aatgcagatttaatggcccttgctgcgccagatgccctgttcatgcactgcctgcctgcc
catataggggaagaagtaaccaaggacgtgtttgaaggcccgcattctgtggtgtttgat
gaggcggaaaaccgccttcatgcccagaaaggcgtgctggcatggacaatgggtggcaca
aactggacctctttcggcaaggaataa

DBGET integrated database retrieval system