KEGG   Acetobacter pasteurianus IFO 3283-03: APA03_18840Help
Entry
APA03_18840       CDS       T01812                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
apf  Acetobacter pasteurianus IFO 3283-03
Pathway
apf00330  Arginine and proline metabolism
apf00332  Carbapenem biosynthesis
apf01100  Metabolic pathways
apf01130  Biosynthesis of antibiotics
apf01230  Biosynthesis of amino acids
Module
apf_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:apf00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    APA03_18840
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    APA03_18840
Enzymes [BR:apf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     APA03_18840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: BAI03062
Position
2050792..2051919
Genome map
AA seq 375 aa AA seqDB search
MTGYTSPSLTNAKRLVVKIGSALVVDPEKQAPRQEWLASVAADIAYLRKQGTAVTVVSSG
AIALARHTLGLAGGALRLAEKQAAAAVGQISLAQAWSNALSAHGLIAAQLLLTPEDTEDR
KRYLNARATLNTLLEMGCVPVINENDTVATAEIRFGDNDRLAARVAQMTDSDQLVLLSDI
DGLYTADPRTNPDAQHLPVIETLTPEIEAMGGEPPPGYSSGGMRTKLLAAGIATRSGCAM
AIALGKTPHPLRSLLEGGRCSWFLPQDCAHTARKQWIAGSLTPAGEIMVDDGAVTALQQG
KSLLPAGVLGVKGDFSQGDLVEIINTDGIVLAHGLAAYDADDARRIAGHRSTELTDILGW
HGRDEIIHRDDLVMI
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaccggatacaccagcccctcccttaccaatgccaaacggcttgttgttaaaataggt
agcgcgctggtggtggacccagaaaaacaggctcctcgtcaggaatggctggccagtgtg
gcggcagatattgcgtatctgcgcaaacagggcacggctgttactgttgtatcttctggc
gctattgcacttgcccggcacacattgggtttggctggtggcgcgctccgtttggcagaa
aaacaggcagccgctgctgtagggcagatcagtctggcgcaggcatggagcaatgctctt
tcggcccacggccttattgccgcccagcttctgctgaccccggaagatacagaagaccgc
aaacgctacctgaatgcacgcgcaacgctgaataccctgctggaaatggggtgcgttccc
gtaattaacgagaacgataccgttgccacagccgaaattcgttttggcgataatgacagg
ctggcagcccgcgttgcacaaatgacggactcggaccagcttgtgctgctgtctgatatt
gatggcctctacacggctgacccacgcacaaacccggatgcacagcatctgcccgtgatt
gaaacccttaccccggaaattgaagccatggggggggaacctccgccgggttattcttct
gggggtatgcgcaccaagctgttggctgcgggcattgctacacgctcgggctgtgccatg
gctattgccttgggtaaaacgccccacccgctccgctctttgctggaaggtgggcgctgc
tcatggttcttgccgcaagattgcgcccatacagcccgcaagcagtggattgcaggcagc
ctgacaccagcaggtgaaattatggtggatgatggtgccgtaaccgcattacagcagggc
aaatctcttttgccagcaggtgtgcttggggtgaagggtgatttctctcagggtgatctg
gtagaaattatcaatacggatggcatcgtgctggctcatgggcttgccgcctatgatgca
gacgatgcccggcgcattgcaggccaccgctccaccgagcttacagatattttgggatgg
cacggacgggacgagatcatccatcgtgatgacctcgtcatgatctag

DBGET integrated database retrieval system