KEGG   Anaplasma phagocytophilum HZ: APH_0372
Entry
APH_0372          CDS       T00327                                 
Symbol
virB3
Name
(GenBank) type IV secretion system protein VirB3
  KO
K03198  type IV secretion system protein VirB3
Organism
aph  Anaplasma phagocytophilum HZ
Pathway
aph03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:aph00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    APH_0372 (virB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:aph02044]
    APH_0372 (virB3)
Secretion system [BR:aph02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   APH_0372 (virB3)
SSDB
Motif
Pfam: VirB3
Other DBs
NCBI-ProteinID: ABD44415
UniProt: Q2GKX3
Position
365015..365308
AA seq 97 aa
MSGSVKADQLFKGLTRPTMLFGVSYTFAIMNFMLSIMIFMYSNDFRVLFILAPGMHGLGF
IASAKDPLFMDLLIIRMQKCSKCLNRFYHNSNSYDVM
NT seq 294 nt   +upstreamnt  +downstreamnt
atgtctggtagtgtaaaagcggatcagctgtttaagggtttaaccaggcccaccatgctg
tttggtgtgagttatacgtttgctattatgaatttcatgctttcgatcatgatattcatg
tatagcaatgactttagggtattgtttattttagcgccaggtatgcacgggttggggttt
attgcgtctgcaaaggatcctttgttcatggatttgctaatcataagaatgcagaagtgc
agtaagtgccttaatcggttctatcacaattctaattcctatgatgtgatgtag

DBGET integrated database retrieval system