KEGG   Anaplasma phagocytophilum HZ: APH_1120Help
Entry
APH_1120          CDS       T00327                                 

Gene name
apaG
Definition
(GenBank) apaG protein
  KO
K06195  ApaG protein
Organism
aph  Anaplasma phagocytophilum HZ
Brite
KEGG Orthology (KO) [BR:aph00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    APH_1120 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: ABD44448
UniProt: Q2GIY5
Position
1182984..1183391
Genome map
AA seq 135 aa AA seqDB search
MTVLECGKEAGLIEVEVTPSYLEEHSIPHENCYIWLYSVRINNRSDSTVQLLKRSWKIID
SKGVVNEVSGSGVAGSQPVLKPGAFFEYTSGTCLSTPSGVMNGWYQFVDEDKAQVFYVDV
PAFSLDSPYDSLRLN
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgacagtgttagagtgtggcaaagaagcaggactaatagaggtagaagtaaccccaagt
tatttagaagagcattctataccgcatgagaactgttacatatggctatatagtgtacgg
ataaacaatagaagtgattctacagttcagctgcttaagcgcagttggaagatcatagat
tccaaaggagtcgtgaatgaggtcagcggatccggagtagctggcagtcagccggtactg
aagccgggagcttttttcgagtatacaagtggtacgtgtttaagtactccttcgggagtg
atgaacggctggtatcagtttgtggatgaggataaggcacaggtgttttatgtggatgtg
ccggcattttcattagatagcccctacgatagtttgaggctgaactaa

DBGET integrated database retrieval system