KEGG   Anaplasma phagocytophilum JM: WSQ_05585Help
Entry
WSQ_05585         CDS       T02754                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
apha  Anaplasma phagocytophilum JM
Pathway
apha00020  Citrate cycle (TCA cycle)
apha01100  Metabolic pathways
apha01110  Biosynthesis of secondary metabolites
apha01120  Microbial metabolism in diverse environments
apha01130  Biosynthesis of antibiotics
apha01200  Carbon metabolism
Module
apha_M00009  Citrate cycle (TCA cycle, Krebs cycle)
apha_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:apha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    WSQ_05585
  09105 Amino acid metabolism
   00310 Lysine degradation
    WSQ_05585
   00380 Tryptophan metabolism
    WSQ_05585
Enzymes [BR:apha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     WSQ_05585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 PYNP_C GCV_H
Motif
Other DBs
NCBI-ProteinID: AGR80319
UniProt: S5PE10
Position
1276510..1277730
Genome map
AA seq 406 aa AA seqDB search
MGDAVEVRAENLGGESILEAPIRVMKKVGDTVSAEDVLFIVETDKTSLEISAPVAGVLTE
LRVADEEVITKGQVLAIIRPQGEATAEGVNKEPESKEEVPAQPVVAQAVSTQKPQEKTII
EGKGLVTPTVEDFVAGINTTPTSRALGMSAKSEQDKKIVASQPSKDLMSCHGDVVGERRV
KMSKIRQVIAARLKESQNTSATLSTFNEVDMSKVMELRAKYKDAFVKRYDVKLGFMSFFI
RAVVLVLSEIPVLNAEISGDDIVYRDYCNIGVAVGTDKGLVVPVIRRAETMSLAEMEQAL
VDLSTKARSGKLSVSDMSGATFTITNGGVYGSLLSTPIINPPQSGILGMHAIQQRPVAVD
GKVEIRPMMYLALSYDHRIVDGQGAVTFLVRVKQYIEDPNRLALGI
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatgctgtagaagttagggctgagaatcttggtggcgaatccattctagaagct
ccgattcgggtaatgaaaaaggtgggagatactgtatctgcagaagatgtgctcttcatt
gttgaaacagacaagacttctcttgaaatatcagcccctgttgctggtgttctcacagag
ttgagagttgcagatgaagaagtgattaccaaggggcaggtcttggctatcatacggcca
cagggtgaggctactgcagagggtgttaataaggagccagagagcaaggaggaggtgcct
gctcaacccgttgttgcacaggcagtgagcactcaaaaaccgcaggaaaagacaattatt
gaaggcaaaggtctagtaactcctactgtagaagattttgttgcaggaatcaacacaact
cctacttctagagctttgggtatgagtgctaagagtgaacaagacaagaagatagttgct
agccagccgtctaaggatctgatgagttgccatggcgacgtggtgggtgaaagacgcgtg
aagatgagcaaaatccgccaagttatagctgctaggcttaaggagtcacaaaatacctct
gctacactcagcacctttaatgaagttgatatgagcaaagtgatggagctcagagctaag
tacaaagatgcctttgtgaagaggtatgatgttaagcttgggtttatgtccttctttatc
agagcggttgtgctagtcctttccgaaattcctgtgctgaatgcggagatttcaggcgat
gatatagtctacagggactattgtaacattggagtcgcggtaggtaccgataaggggtta
gtggtgcctgttatcagaagagcggaaactatgtcacttgctgaaatggagcaagcactt
gttgacttaagtacaaaagcaagaagtggcaagctctctgtttctgatatgtctggtgca
acctttactattaccaatggtggtgtgtatgggtcgctattgtctacccctataatcaac
cctcctcaatctggaatcttgggtatgcatgctatacagcagcgtcctgtggcagtagat
ggtaaggtagagataaggcctatgatgtatttggcgctatcatatgatcatagaatagtt
gacgggcaaggtgctgtgacgtttttggtaagagtgaagcagtacatagaagatcctaac
agattggctctaggaatttag

DBGET integrated database retrieval system