KEGG   Anaplasma phagocytophilum JM: WSQ_06560Help
Entry
WSQ_06560         CDS       T02754                                 

Definition
(GenBank) hypothetical protein
  KO
K03203  type IV secretion system protein VirB8
Organism
apha  Anaplasma phagocytophilum JM
Pathway
apha03070  Bacterial secretion system
Module
apha_M00333  Type IV secretion system
Brite
KEGG Orthology (KO) [BR:apha00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    WSQ_06560
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:apha02044]
    WSQ_06560
Secretion system [BR:apha02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein [MD:M00333]
   WSQ_06560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VirB8 TraE DUF4808 COX7B
Motif
Other DBs
NCBI-ProteinID: AGR80410
UniProt: S5Q2P8
Position
complement(1475994..1476710)
Genome map
AA seq 238 aa AA seqDB search
MVLDMFGLGKEKKKPVTGSERDCVSGKIGDWYHDRYGSVVVQRNILLLLVVLSVFCIAVS
TFVIFRIGKTRTIEPFVVEIEKKSGITTLVNPMTVKQYSADEVLSNYFIVEYIKARELYD
PNNFQYNYYTRVRLLSSQETYSEFRSWIRPSNPSSPMTLYSDVVSGALKVRSLQHLEGGQ
VQVRFTMEFVNHSGSIVKRDRIATLSFRYSSLEMTEQDRQVNPLGFQITYYRADDEFL
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
ttggtattggatatgtttggtcttggaaaggaaaaaaaaaagcccgtgacaggttctgag
cgcgattgcgtgtcgggaaagatcggagattggtatcatgacagatacggttccgtggtc
gtgcagcgcaatatactccttcttcttgtagtgttgtcggtattttgtatcgctgtaagt
actttcgtcattttcagaatagggaaaacaagaacaatagaacccttcgttgtagaaata
gaaaagaagtcagggattacaacgctagtaaacccgatgactgtaaaacagtattctgcc
gacgaggtattaagtaattattttatagtggagtacataaaggctcgtgagctctatgat
cccaacaatttccagtataactactatacgagagtacgtctcctttcgtcccaagaaacc
tatagcgagtttcgtagttggatacgtcctagtaacccttctagtcctatgacgctttat
tcggatgttgtatcaggagctctaaaagtgcgctctctgcaacatctagaaggagggcag
gttcaggtgcggtttactatggaattcgttaatcatagcggctcgattgtaaagagagat
agaattgctactctttcctttaggtattcctctcttgagatgactgaacaagatagacag
gtgaaccctttgggcttccagatcacttactatagggcggatgatgaatttctataa

DBGET integrated database retrieval system