KEGG   Acyrthosiphon pisum (pea aphid): 100158679Help
Entry
100158679         CDS       T01076                                 

Definition
(RefSeq) endoplasmic reticulum resident protein 44
  KO
K17264  endoplasmic reticulum resident protein 44
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
KEGG Orthology (KO) [BR:api00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:api04131]
    100158679
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:api04147]
    100158679
Membrane trafficking [BR:api04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    100158679
Exosome [BR:api04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100158679
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin_6 Thioredoxin Calsequestrin OST3_OST6
Motif
Other DBs
NCBI-GeneID: 100158679
NCBI-ProteinID: XP_001951494
APHIDBASE: ACYPI000119
UniProt: J9JIZ2
Position
A2
AA seq 409 aa AA seqDB search
MNQNYWKIFANKLFLLFFSSAYLFYNPVTGNAVKLNSQNVDMTLASNELVIINFYADWCR
FSGILTPIFEEAAAKVSELYPESGKVVLGKVDCDTETSIASRFQITKYPTIKVLINGQPA
KREYRGKRSVEAFVSFVQKQLEDPIQEVSSLFAKADVKSRVVIGYFENKDSQEYQVFRKV
ATNLKDDCLFYAGVGETFRAMHPPNETIIEFRPDRASPKSEHHTFRGNSADYDSLNIWAT
DNCLPLVREITFENAEEITEEGLPFLLFFYHPDDLESIKLFKEIVGTYLIQEKQRVNFLT
ADGVKFAHPLQHLGKRHTDLPVVVIDSFKHMYQFPEKSDYKNHEHLKTFIDDLYSGKLHR
EYHLGPQEISAIEVIHGHNQPAEQTMPPESTFKKLAPSKNRYTLLKEEL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaaattactggaagatattcgctaataaattgttcctgttgtttttttcttct
gcctatctgttctacaatccagtaaccggcaatgctgtaaaactcaacagtcaaaatgtt
gacatgacattagcatctaatgagttagttataataaacttctatgccgattggtgtcgg
tttagtggtattcttactccaatatttgaagaagctgctgcaaaagtttctgaactttat
ccagagtccggtaaagttgtgttggggaaagtagactgtgatactgaaacttccattgca
tctagatttcaaattactaaatatcctactataaaagtattaatcaatggacaaccagct
aaaagagaatataggggtaagcgatcagttgaagcatttgtgtcttttgtacaaaaacag
cttgaagacccgatacaagaagtgtccagcttgtttgccaaagctgatgtgaagtcaaga
gttgtaattggatactttgaaaacaaagattctcaagaataccaagtatttagaaaagtg
gcaacaaatctcaaagatgattgtcttttttatgctggagttggtgaaacattccgtgct
atgcatccacccaacgaaacgataatagaattcagacctgaccgggcatctcccaaatct
gaacatcatactttcagaggaaattcagccgattatgattcgctaaatatttgggcgact
gacaattgcttaccattagttcgcgaaataacgtttgagaatgctgaagaaatcacagaa
gaaggattaccattcttactatttttctatcatcctgatgatttggagtccattaagctg
ttcaaagaaattgttggcacatatttaatacaagagaaacaacgcgttaactttttgacg
gccgacggcgtcaagtttgcacatccattacagcacctgggaaaacgacatactgattta
cctgtagtcgtcattgatagtttcaaacacatgtatcagttcccagaaaaaagcgattac
aaaaaccatgagcatctgaaaacatttattgatgatctgtactccggtaaattacataga
gaatatcatttgggtcctcaggaaatttctgccatagaagtaatccatggtcataaccaa
cctgctgaacagacgatgccaccagaatctacttttaagaaactggcaccgtctaaaaat
cgttacacattattaaaagaagaattatag

DBGET integrated database retrieval system