KEGG   Acyrthosiphon pisum (pea aphid): 100159484
Entry
100159484         CDS       T01076                                 
Name
(RefSeq) bifunctional coenzyme A synthase
  KO
K02318  phosphopantetheine adenylyltransferase / dephospho-CoA kinase [EC:2.7.7.3 2.7.1.24]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api00770  Pantothenate and CoA biosynthesis
api01100  Metabolic pathways
api01240  Biosynthesis of cofactors
Module
api_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:api00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    100159484
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:api03029]
    100159484
Enzymes [BR:api01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.24  dephospho-CoA kinase
     100159484
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     100159484
Mitochondrial biogenesis [BR:api03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Other mitophagy factors
    100159484
SSDB
Motif
Pfam: CoaE CTP_transf_like AAA_18 AAA_33 FAD_syn
Other DBs
NCBI-GeneID: 100159484
NCBI-ProteinID: XP_001944795
APHIDBASE: ACYPI000851
UniProt: J9JKZ4
Position
X:complement(60842227..60845438)
AA seq 516 aa
MANTGLLICSNPFRLLRIFPQIQRDVQSTLYVHFFPLPMPDKKTVRHRFMMIDAYKNLSP
MNVDVRILLCGLKGTLNSQITTKRPVDVIFYDDHIKSEQLHHVMSSLSNKSPNCKTVFVQ
PNEAYSSNDTKENNQYDEMENKLYESVVLGGTFDRLHKGHKILLSTAALKCTRKLTVGVT
DISMLDDSKKLKELIEPCNTRISNVEGFLKDIDPTLEYEVLPIYDIYGPTIHDPTFQMII
LSEETVKGGELINEKRIQANLRPLDIIPVPLLEEDKSTSDCCEEEEQKISSSNYRMRMLG
TLLKPPQPNPNIPSCPYIIGLTGGIASGKSSIANYLKDLGAFVINADTVAHKLYDINQPA
YQAVIDVFGSSILTTNKEVDRKKLGAIVFSDKDKMEQLNTILWPLILKRVKSIIQSTKGH
NIVVLEAAVLLSANWQDHCHEIWVSIIPRKEAEIRLQERNKLSKKQALERIESQPSNYEY
VENANVLFSTLWSYNFTHIQIKRAWNSLLSRVSSNH
NT seq 1551 nt   +upstreamnt  +downstreamnt
atggctaatactggattgttgatatgttcgaatccatttcgtctgcttcgcatatttcca
caaatacaacgcgatgtacaaagtacgctttacgtccatttctttccgcttccaatgccg
gataaaaaaactgtacgacatcgattcatgatgatagatgcttacaaaaatctaagtccc
atgaacgtggatgtgcgcatcctcttatgtggtctcaagggcacattaaactctcagatc
accactaaacgaccagtagatgtgattttttatgacgaccatataaagtctgaacaactt
catcatgtgatgtcgtcattaagtaacaagtctcctaattgcaagactgtattcgtacaa
ccaaatgaagcttatagttcaaatgatacaaaggaaaataaccaatacgatgaaatggaa
aataaactgtacgagagtgtggttttaggtggcacttttgatagattacacaaaggccat
aaaatattattaagtacagctgcgctaaaatgcactagaaaattaactgtgggcgtaacc
gacatttccatgttagatgattccaaaaaattaaaggaacttattgagccttgtaatact
cgaataagtaatgttgaaggatttttaaaagatattgatccaacattagaatatgaagta
ttgcctatttatgatatttatggtccaacaattcatgatcctacatttcagatgattatt
ttaagtgaagaaactgtgaaaggtggagagttaattaatgagaaaagaattcaagctaat
ttacgacccctcgatataatacctgtgccattattagaggaagataaatcaacaagtgat
tgttgcgaagaagaagaacaaaaaataagttcaagcaattatcgcatgcgaatgttaggt
acactcttaaaaccaccacaaccaaatcctaatataccctcatgtccatatattattgga
ttaactggtggaattgcaagtggtaaatcatctattgctaattatttaaaagatctagga
gcttttgtaatcaatgctgatactgtggcgcataaactttatgatataaatcagcctgca
taccaagctgttattgatgtgtttggttctagcatactgactacaaataaagaagtagac
agaaaaaaattaggtgccatagtttttagtgacaaggataaaatggaacaattaaataca
atactttggcctctaattttgaaaagagtaaaatcaataatccaatcgaccaaaggtcat
aatatagttgtattagaagcagctgttcttttaagtgcaaattggcaagaccattgtcat
gaaatatgggtttcaattattccacgtaaagaagctgagataagacttcaagagcgcaat
aaattgagtaaaaaacaagcgcttgaacgaattgagtctcaaccatcaaattatgaatat
gttgaaaacgcaaatgttttattttcgacattgtggagctataattttactcatattcaa
attaaaagagcatggaatagtcttttgagtagagtttctagtaaccactga

DBGET integrated database retrieval system