KEGG   Acyrthosiphon pisum (pea aphid): 100159536
Entry
100159536         CDS       T01076                                 
Name
(RefSeq) ribosomal protein L44e-like
  KO
K02929  large subunit ribosomal protein L44e
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api03010  Ribosome
Brite
KEGG Orthology (KO) [BR:api00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    100159536
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:api03011]
    100159536
Ribosome [BR:api03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    100159536
  Archaea
    100159536
SSDB
Motif
Pfam: Ribosomal_L44 zf-C2HCIx2C Rpr2
Other DBs
NCBI-GeneID: 100159536
NCBI-ProteinID: NP_001155403
APHIDBASE: ACYPI000896
UniProt: C4WUD6
Position
A1:complement(153049033..153050772)
AA seq 104 aa
MVNVPKQRRTYCKKCKVHKVHKVTQYKKSKERQASQGRRRYDRKQSGFGGQTKPIFRKKA
KTTKKIVLRMECSECKYRKQIPLKRCKHFELGGDKKRKGQMIQF
NT seq 315 nt   +upstreamnt  +downstreamnt
atggtgaatgtacctaaacagagacgtacgtactgcaagaaatgcaaggtacataaggta
cacaaggtaacacagtacaaaaaatctaaggaacgtcaagcttcccagggtcgtcgtcgt
tacgaccgaaaacagagtggtttcggtggtcagactaagcctattttcagaaagaaggct
aaaacaaccaaaaagattgtcttaaggatggagtgttctgaatgcaaataccgtaaacaa
atcccattgaaacgttgcaagcattttgaattgggaggtgacaagaaacgaaagggccaa
atgatccagttttaa

DBGET integrated database retrieval system