KEGG   Acyrthosiphon pisum (pea aphid): 100159685
Entry
100159685         CDS       T01076                                 

Definition
(RefSeq) takeout-like precursor
Organism
api  Acyrthosiphon pisum (pea aphid)
SSDB
Motif
Pfam: JHBP
Other DBs
NCBI-GeneID: 100159685
NCBI-ProteinID: NP_001156072
APHIDBASE: ACYPI001035
UniProt: C4WUR2
AA seq 258 aa
MAKSLLIVSALFLAVVASVTAAPTPKKQIAFNLCKKSDPNLDRCLKTSIQSVIPDLAEGY
PKLRIPAIEPFELPSLEIEHGKGSSKAVSIDLKLKDVKIMGLTSAVVDALKVDVDNFKTS
GKISFTKPLEITGQYTVNGKVLVLPITGNGPCSIVLNEPVLELEEMSGTPFEKNGKTFVQ
IKKVNLKVASVKNLNVKLENLFNGNKQLGDSMNSILNQNWEVLLEELKPAFEEAIGAISQ
DIVNKVFQKTAYSDIFLL
NT seq 777 nt   +upstreamnt  +downstreamnt
atggcaaaatcgttgctgatcgtttctgctttatttttggccgtcgttgcatctgtaaca
gctgcacccacaccgaaaaagcaaatagctttcaacctatgcaagaaaagtgatccaaac
cttgacagatgtttgaagacctccatccaatcagttattccggatttggccgaaggatac
ccgaaactgaggattccggccatcgaaccgttcgagttaccgtcattggaaatcgaacac
ggaaagggctctagcaaagctgtcagtattgacttgaagttaaaggacgtcaaaatcatg
ggtttgaccagcgcagtggtcgatgccttgaaagtcgacgtggacaacttcaagacgagc
ggcaagattagcttcacaaagccactcgagatcactggacaatacacggtcaacgggaag
gtgctcgttttgccgatcaccggaaacggaccgtgttccatcgtcttaaacgaacccgtt
ttggaattggaagaaatgtccggtactccattcgagaagaacggtaagaccttcgttcaa
atcaagaaagtcaacctgaaggtggcgagcgtcaaaaatctgaatgtcaagttggaaaac
ctcttcaatggaaacaaacaattaggcgatagcatgaactccatcctgaaccaaaactgg
gaagttcttcttgaagaattgaaaccagcattcgaagaagcgattggagctatctcgcaa
gatatcgtcaacaaagtatttcagaagaccgcgtactcagacatattccttttgtaa

DBGET integrated database retrieval system