KEGG   Acyrthosiphon pisum (pea aphid): 100159919
Entry
100159919         CDS       T01076                                 
Name
(RefSeq) inositol polyphosphate 5-phosphatase OCRL-1
  KO
K01099  inositol polyphosphate 5-phosphatase INPP5B/F [EC:3.1.3.36]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api00562  Inositol phosphate metabolism
api01100  Metabolic pathways
api04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:api00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100159919
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    100159919
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:api04131]
    100159919
Enzymes [BR:api01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.36  phosphoinositide 5-phosphatase
     100159919
Membrane trafficking [BR:api04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    100159919
 Endocytosis
  Clathrin-mediated endocytosis
   Inositol 5-phosphatases
    100159919
  Rab GTPases and associated proteins
   Rab associated proteins
    100159919
 Protein recycling
   Other Rab GTPase associated proteins
    100159919
 Endosome - Golgi transport
   Rab associated proteins
    100159919
SSDB
Motif
Pfam: INPP5B_PH RhoGAP Exo_endo_phos Motile_Sperm
Other DBs
NCBI-GeneID: 100159919
NCBI-ProteinID: XP_008183390
APHIDBASE: ACYPI001258
UniProt: J9JM18
Position
A2:103905960..103911043
AA seq 864 aa
MELSAIMKDKLNAGDNVVALHEGVLLQGWSPKAHRLLALVERNLSFGLFVFTTSRNPPQA
FTDLTINFVVPIDSDFKCDIDSLSAESNSDIYINLSARNFKLFMGMDSGHETNHFFNELS
RSMDLYLKNQQTLDFQWLKKYNINDIDLELGLMMNINGDNTSNNIITANMAVAENDISFP
TGTQTLSSRESVIQRQMILSEEQYTNAQNFRIYIGTWNVNGQPTLSSLNDWLTCDSEPPD
IYAIGFQELDLSKEAFLFNDSPREEEWLQAVTKSLNSKGNYKKVSLVRLVGMMLIVFVKN
KHMDHVKNVATDTVGTGIMGKLGNKGGVAVRMDFHNTSLCFVNTHLAAHVEEYERRNQDY
QNICSRMVFSNFIPPKTVKDHNQVYWFGDLNYRITEMDAISVKDLVRKNNFKNVLEADQL
KQQHRAGNVFKGYKEGSINFLPTYKYDPGTNDWDSSEKNRAPAWCDRILWRGNSIKQLAY
RSHPNLLISDHKPVSALFESEVRVVDLTKYRKIHEHIMKKLDKAENEYLPQVMVDNTEII
FHNVKFMEPQLKELTVANTGQVPVQFEFIKKLDDSTYCKEWLRIEPFMSFIDPGEKCDIT
LEVLIDKKSAYKMISGQDKLYDILVLHLDGGKDIFITVTGNYERSCFGCSLETLCYLKVP
IKNIPFGKLMELENNKSNMTSDPYPVPKEVWYLVDHLYRHGLKQEHLFEHSGLRSEFVQI
RNWLDNGTPDALPGSVHSVAEALLILLDSTSEPIIPYNLHATCLSAVSYYSQCKQIISQL
PERSKNVFLYLCAFLQELLNHVNDNKLDVKTIASVFGEIFIRDPPRSRSDKSGHTRTSMS
RKKTNFVYHFLVNDQSDLIINTSF
NT seq 2595 nt   +upstreamnt  +downstreamnt
atggaactatccgctattatgaaggataaattgaatgccggtgacaatgttgtggcgctc
cacgaaggtgtactgttgcaaggctggtcacccaaggctcaccgattattagccttggtt
gaacgtaatctgtcatttggtttgtttgtatttacaacatccagaaatccaccgcaagca
tttacagacctcacaatcaactttgttgtgcccattgatagtgatttcaaatgtgatata
gattcattgtcagcggaatcgaattctgatatttatattaatttatcagcacggaatttt
aaattatttatgggaatggattcaggtcatgaaactaatcatttttttaatgaattatcg
agatcaatggacctttatttaaaaaatcaacagacactggattttcaatggttaaaaaaa
tataatataaatgatattgacttagaattaggtttgatgatgaatatcaatggtgataat
acatctaataatataataacagctaatatggctgtggctgaaaatgatatatcatttcca
actggaacacaaacactaagttctcgagaaagtgttattcagcgacaaatgattttgagc
gaagaacaatatactaatgcacaaaatttccgtatttatattggcacttggaatgtcaat
ggccaaccaaccttgtcttcactaaatgattggctgacttgtgactctgaaccgcctgat
atttatgccattggttttcaagaacttgatctaagtaaagaagcgtttctttttaatgat
tctccacgagaagaagaatggttacaagctgtaacaaaaagtcttaattccaagggaaat
tataaaaaagtatcattagttcgattggtgggaatgatgcttatagtgttcgttaaaaat
aaacacatggaccatgttaaaaatgttgccactgatactgttggtactggaattatggga
aaattgggaaataaaggtggagtggctgttcgcatggatttccacaacacttctttatgc
tttgtcaatacacatttagcagcccatgttgaagaatatgaaagacgaaaccaagattat
caaaatatatgttcaagaatggtattttcaaatttcatacctccaaaaactgtaaaggat
cataatcaagtatattggtttggtgaccttaattataggataaccgaaatggatgcaata
tccgtaaaagatttagtacgcaaaaataattttaaaaatgtgttagaagcagatcaacta
aagcaacaacatcgggctggaaatgtctttaaaggttataaggagggttcaattaatttc
cttcctacctataaatatgatccgggtaccaatgactgggacagcagtgagaagaaccgt
gcccctgcatggtgtgaccgaatattatggcgaggcaattcaattaaacaacttgcttac
agaagtcatcctaatttgttgatcagtgatcacaaaccagtcagcgcattatttgaatct
gaagtgagagttgttgatttgaccaagtacagaaaaattcatgaacatataatgaaaaaa
ctagacaaagcagagaatgaatatttacctcaagttatggttgataacactgaaataatt
ttccacaatgtgaagtttatggagcctcaattaaaagaacttacagttgctaatactggt
caagttcctgtacagtttgaatttattaaaaaattagatgattctacatactgtaaagaa
tggttgcgaattgagcctttcatgagttttattgatcctggggaaaaatgtgatattact
ttagaagttttgatagataaaaaatctgcatacaaaatgatcagtggccaagacaagttg
tatgatattttagtattacatttagatggcggaaaagatatatttataacagttacaggt
aattacgagcgaagttgttttggttgttcattagaaacactttgttatttgaaagttcct
attaaaaatataccatttggaaaacttatggaacttgaaaacaataaaagcaacatgacg
tcagatccttacccagtacccaaagaagtatggtaccttgtggatcatttatacagacat
ggtctcaaacaagaacatttatttgaacattctggtctcagatctgaatttgtccagatt
cgaaattggttagataatggaacaccggatgctttacccggtagtgtgcattctgtagct
gaagctctattaattctattagacagtacatcagaacccataataccatataatttgcat
gcgacttgtttatctgcagtgtcttattacagtcagtgcaaacaaattatttctcagcta
ccagagagaagtaaaaatgtatttttatacctttgtgcatttcttcaagaattattgaat
catgtcaatgataacaaattagatgttaaaactatcgcatctgtttttggtgaaatattt
atccgagatcctcccagatctcgatcagataaatctggccacactagaacttctatgtca
aggaagaagaccaattttgtataccattttctagtcaatgatcaaagtgatttaataatc
aatacatccttttag

DBGET integrated database retrieval system