KEGG   Acyrthosiphon pisum (pea aphid): 100159954Help
Entry
100159954         CDS       T01076                                 

Definition
(RefSeq) enoyl-CoA hydratase, mitochondrial
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api00062  Fatty acid elongation
api00071  Fatty acid degradation
api00280  Valine, leucine and isoleucine degradation
api00310  Lysine degradation
api00380  Tryptophan metabolism
api00410  beta-Alanine metabolism
api00640  Propanoate metabolism
api00650  Butanoate metabolism
api01100  Metabolic pathways
api01200  Carbon metabolism
api01212  Fatty acid metabolism
Module
api_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
api_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
api_M00085  Fatty acid biosynthesis, elongation, mitochondria
api_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100159954
   00650 Butanoate metabolism
    100159954
  Lipid metabolism
   00062 Fatty acid elongation
    100159954
   00071 Fatty acid degradation
    100159954
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100159954
   00310 Lysine degradation
    100159954
   00380 Tryptophan metabolism
    100159954
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100159954
Enzymes [BR:api01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100159954
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-GeneID: 100159954
NCBI-ProteinID: XP_003243793
APHIDBASE: ACYPI001292
UniProt: J9JM53
Position
Un
AA seq 292 aa AA seqDB search
MAIFLRSSVCKSKLVFSLSKIATPVTSMKLSTCNLEYIITEKVGEKQNVGLVKLNRPKAL
NALCDGLVTELTEAVSAYDADDSIGAIVVTGSERAFAAGADIKEMLDKTYSTNLKIGLLK
QWDNLSKCKKPVIAAVNGFALGGGCELAMMCDIIYAGEKAKFGQPEIVIGTIPGAGGTQR
MIRSCGKSFAMEVCLSGNQISAQEALSRGLVSKVFPPEKLVDEAIKLAEKISEHSPLIVA
LCKESVNYAYESSLSQGLQFEKKSFYGTFATDDRKEGMTAFIEKRKPNFSNN
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggcaatttttttgagatcgtcagtgtgtaaatcaaagttagttttttcattatcgaaa
attgcaacacccgtaacttcaatgaagctgtccacatgtaacttggagtacataattact
gaaaaagttggtgagaaacaaaatgttggcctggtaaaacttaataggcctaaagctttg
aatgctttatgtgatggtttggtcacagaactgaccgaagccgtatctgcttatgatgcc
gatgattcaattggagctattgttgttactggtagtgaacgtgcatttgcggctggtgct
gatatcaaagaaatgcttgacaagacttattctactaacctaaaaattggtctactcaaa
caatgggacaatctgagtaaatgcaagaaaccagttattgctgctgtaaatggtttcgct
ctaggtggtggatgtgaattagcgatgatgtgtgacataatctatgctggagaaaaagct
aaatttggccaacctgagattgtgattggtacaattcccggagccggtggtactcagcgt
atgatacgttcttgcggtaaaagctttgcaatggaagtatgtttatctggaaaccagatt
tctgctcaagaagctttatctagaggattagttagtaaggtgttcccaccagaaaagtta
gttgatgaggctattaaattagctgaaaaaataagtgaacattcacctttaattgttgca
ttatgtaaagaatctgtaaattatgcatatgaatcaagtttaagccaaggtttacaattt
gagaagaagtcattctatggaacttttgcaaccgatgaccggaaggaaggaatgaccgca
ttcattgaaaaaagaaaaccaaacttttctaataattaa

DBGET integrated database retrieval system