KEGG   Acyrthosiphon pisum (pea aphid): 100160310Help
Entry
100160310         CDS       T01076                                 

Definition
(RefSeq) titin isoform X1
  KO
K12567  titin [EC:2.7.11.1]
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
KEGG Orthology (KO) [BR:api00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:api01001]
    100160310
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:api04131]
    100160310
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:api04812]
    100160310
   04147 Exosome [BR:api04147]
    100160310
Enzymes [BR:api01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100160310
Protein kinases [BR:api01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   100160310
Membrane trafficking [BR:api04131]
 Others
  Actin-binding proteins
   Others
    100160310
Cytoskeleton proteins [BR:api04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     100160310
Exosome [BR:api04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100160310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 ig Ig_2 Titin_Ig-rpts V-set fn3 C1-set Ig_4 C2-set_2 SH3_9 SH3_1 SH3_2
Motif
Other DBs
NCBI-GeneID: 100160310
NCBI-ProteinID: XP_029342894
Position
A1
AA seq 16705 aa AA seqDB search
MNRQHQQQQQQQQQITTTTTSSLSNTGQRSVNRTEQQVTRQFTQTTQRQVHEGFIVQQST
PKFGNDAAPPVFEQIFKNARFAQGGNAVFEGKVTGIPKPFVSWTRKGAPLLESNKYKMTY
DQQTGNVVLTINQIGPGDEGEYTCSARNQYGEAICSVFIQPEGHTVQIPQGTYGSQRVQQ
TQNTLYTNNYSNIDEDFKVDTFEYRLLREVSFRQSVTKRYLGEEDVKFTSSAHQGPVVAP
QVLQKPRNSKLVEGSNATFTVKVSTAKDTRLTWFKNGQRLVNGPKHQINFTNQVATLSIP
QVCCEDSGHYTLLVENPQGCVVSSAYLAIEPTSIAYDRTEDKENVITKTHNKLESIEVVE
GKMLAPNFVRVCGDRDVTEGKLTRFDVRVTGKPYPEVSWYINGQQIKDDATHKILVNESG
DHGLMITNVSQADAGQVVCVARSKSGETSFQCNLGVVEKELVVSPKFVQRFTPLNINEGE
TVTLSVRAVGTPVPRITWQKDGVNISEQPGMVSVWTEGGGSVLEIARASPTDAGWYQCTA
QNTAGSTATRARLNIIRKPRPEDFSEDRRLRLPKPTRVIEPEPEPEPEVVFLKHVERAKY
HTPRPEEDKIYPPPRFIVPLANISQQEDGRIHFEARIEPIGDPTMVAEWFVNGYPLQASS
RAMTLLNYGFIALDLLSIVSDDAGEYTCRVTSSSGTAQSTAVLKVEGRDEIDKSSQYPDS
LKYIEQLEDYSKYQRSDSYDEVQPLPPTLVKSLHDMGNLQEGRNAHFEAQLNPVSDPTMK
VEWYKDGKPITASSRITTIFNFGYVSLNIMHLRAEDSGEYTLRAINRWGEIISTSTLNVI
AHSSITGDLGYPEQQRYIDQTEALEQSYLQQKNQEYKISAPESVAPPQFKTPIKDQQNIK
EGGFAHFEARLEPLGDSTLQVEWLKDGKPVEASSRMTVFFNFGYVALTIKYVTVFDIGTY
TCRAYNNLGDASTSATLTVLTRKDVVQDSQHPGGLERFQYLEDSRKNKRKAEEETVVTQK
PRFLGPLKGTNKIAEGQRAHFEVRVEPQNDVTMKIEWYFNGRVIMSANRIQTYHDFGYVA
LDILGVRAEDSGTYVVVARNALGEAQLSSTMQVEVRSNIDTSTMHRGVVEKAPYLESKKF
TEPQYDIEEISKSRPIFIQPLSDPAPLNEGKNVHLECRLEPMGDPTMRVEWFQNGKPVTV
GSRFRTYYDFGYVALDIIHVTSIDSGEYTVRATNHLGSAHTSACVNVLCRSDILTESQNE
YALEQIQMLEDASRYQKMTTEEESIMQAPQFTKPLHNIQTSEGTNIHLECRLKPVGDPTM
KIDWLVNGRPVKTGHRFRPAYDFDYVALDLLSVYPEDSGVYTCQARNEMGEAVTSSSVKV
IAKQNLILDSQHPHGLEKIQYLEDSARYKKAEMIEESVKIKPRFLSKPKNVENLKEGQHA
HFECKLEPVTDSNLEVQWFKNGKPIIIGHRFRPIHDFGYVALDIIDVIEEDTGTYTCRAV
NLLGVDETNVHLTCRSSSGIVTDTQNEMGLEQIQYLEEKSRYNRREDIEETTTQAPIFTT
SLKHCDIKEGQRAHFECRLIPVSDNTMKVEWFHNNVPIKFGSRFTETNNFGFVALDILQC
LPEDSGTYTCRATNWLGQSITSGNLNVQSRKSIYLESQHEDALGRLAQLENSNRYQRQSI
IEDAVTQAPVFTQPMRDSTMIESQPAHFEARLIPVGDDKLKVEWLRNGIPIQASNRVSTM
HDFGYVALNLKYVYPEDSGTYTCRAINDLGQAVTSATLNVHSKASLQLESQHEAALDKLR
QLEDSNRYKRTEQKEVEVTEAPKFIVPLNGTESLIEGQSAHYECRIEPYPDHTLQLEWLH
NGKPLQTGHRFRTTYDFGFASLDVLSALPEDSGEYTCRAINKLGRAESSVKLGVQSRASI
ISDTQHQGALNKIQYLEDDSRFKRAAAEDVLMTEKPQFGRPLKNIEHLPEGRSVHLEATL
IPVNDPTMKVEWYRNGIPIPQGHRFKTVYDFGFVALDVLYAYPEDSGTYMCKAKNAAGEA
VTTCIVTVDSKSGLQLDTLDEDRLKKIKQLEAYERPTAQEAVFELQKPVFLTPLNSLELL
KEGEHAHLETRIEPINDADLKIEWFVNGVAIKTGHRFKTTHDFGYVALDILYAYAEDSGT
YMCKATNKKGEAVNTCQINVASRRSIYLETQHPDGLEKIRELEAQGRPAKLEINEPPPTV
PTLTDLWGTTEVAEGKTAHFECQVKPIHDSKLKVEFFHNDKPLGSASRFHTTYDFGYISL
DIGHVVPEDAGKYTVKATNELGQATSNINLLVQGGGSIILDSQRPEGLEKIKELEMAVPF
KRADYSEPISKQRPMFTQPLQNIDSINEGQTAHFECRLIPIGDSSMTVEWFRNEKPIETS
SRITKTYDFGYISLDISHVRDEDNGVYSCKATNALGEAVSTASMRVRTKSDIQLESQHPE
GLKKIVELERSQEPLKREEAERSFEKPIFTQLLTGPSELIEGQHAHFECRVVPVGDPTLR
FEWYVNGVELKMGSRFQVTNDFGFVTLDISSTVAEDSGVYTCKAINRAGEAVSSTSMKIK
HRSSIIHEPIQPDAWEKIQLKEAEMNKVPEMFIDTRPQQAPVFTSHLQNQDRLAEGQHVH
LEAQVEPRADPNLRIEWFKNGVTLTTGSRIRSTFDFGLVTLAINSLRPDDSAIYTCKASN
LLGEAVSTCTLKISDSHWLLSNTLHPESLSKIEDLEKPHAGQVEGPEPVFESPVFISHLN
NWECKEGSDVHFECQVEPSKDPTLKIDWFVNGKPLQSAARFKSAYDFGFVTLDIHHAYSE
DSGIYTCKASNSKGQAVTTGTLKCTGLQGIHLDTQHPQGKTGLEKVQKVEDNLASKYQRQ
ASLPEAAFPKPIFVVPLEAEFILAESKPLHLEAQVEPKNDPNLKIEWYFNGKVLDLGSRF
KTNNDFGFISLDLTDVYERDQGVYTCKAYNHSGETYTSTTVYCSSNKGLIEHTQHPKGEE
GLEKIQSLEESLQRQKQGITDKETGHAPVFTSQFKDLGFLSEGEIAHYEASLTPVGDQKM
VVEWFYNGNAIEASHRIRTIYAFGMVVLEILGTKIADTGTYTCKATNDYGSAEMSVTLEC
VERITGQKPKFTSQIQTLVGLKDGDSAHFECTLIPVNDPDLKVEWFHNGQPLLHKNRVKM
ISDFGFVVMDIAYIQNHDSGEYVCKASNKYGEDITKATIQYSGKGGVYLDSLQPTSLARI
HELENATGQPSGFASSPVLEAPKFTTQLVDITNLKEGQSAHFEARVTPVNDPNLVVEWYF
NGEKLQHGHRFRTFHDFGIVILDILYCYEENSGVYECRAFNKAGTDTTKANLRCSSKTNL
ILDSQLPRGMEGGLEKIQTLEDLTLRVKDERVSVENRQAPMFTEPLSNIDSLREGESAHF
EGRLTPVDDPNLKVEWFWNGKPLKAGSRFRTFCEFGFVILEISPVYPEDSGEYSCRASNH
FGEAVTTASMKVQGKRSIIFESQLPKGMDTTIDRIAELEGLGKSRATIETEDDLGRAPEF
ITTPADLSLSENSLAHFECRLVPSNDASMTVTWFHNGKVLSAGSRIKTINDFGFVILEVA
GVYIRDSGLYTCKAINKHGEATVSCKLQVKGRQGIVLEPQLPNTFRSGTKSIQKLEENMY
KKEEILAEDEKPNPPRFTVELKDALDVQEAKSVHFECRVEPVNDSTLRIDWFFNGKPFAT
GSRVHVINDFGFISLDMDYVYSRDSGEYICRATNKWGTAFTKAKLTCTAKQNVILESQLP
DGMSGEKLKALEQGPVQEKKIHDEIEAMPPKFLAQIESTTVEEASSVHFETRVEPKNDPK
LRVEWYRNGKPLPSGHRYKSIFDLGFVSLDILSMYSEDSGEYICRAVNDHGEAITKAMVT
CKQLPTILLQNQVPKGMKKSEALTQMEAAIKKYTSEIHLTIDDLYEVEKKQPPRFVTQIK
DQLSLVEMESTKFECQLAPVGDPNMKVEWFLNGKPLRHKNRFNPIYDFGYVAMNFGWIYP
EDSGEYVCRATNLYGQDETRATIKTSGKPGIIYDSQLPKGMKSIEKIREMEASWQVTPEM
KEEEEKRREPPQFVSKPEPVTICEGDWARFCCRVTGFPRPRVMWLVNGNTVVNGMRYKLN
YDGMWHLDIPKTRQYDHGKVEVIARNACGETRVETMLTVNSRHDDYRGVLKNSPRPWYDS
DLVQYQKDLKENELEKVFTDRASNVQNVDYSNMIISTVGVQMKQKQLNESKPEWTEAVKQ
KKNEDYYSKLSKLEGDQVVKEARIREASHQVSLAGEKLKTTSKNMSSNYEESLEKDKKEE
LMPWQKTKLLKSRGDQSQQIIPDPSESSVHGKEIHVAKQQQTQKEIQGDKEIRRKITATE
TTEVEHTRKNQERVVQGKVEPSKPPVFTTKIQPCRAFEQDQARFEVEFDGEPLPTIKWYR
EDFLIQNSPDFQIHTFSTKSILIIRQVFMEDSGVFAVIAENRGGKAKCSANLLVEERKQV
GRKGPGPPSFLTTMQGAVVKAGQLVRFDVKISANKPLDVYWLKNGKKITQDIRYKTVDED
NQYTLLIIESVTEDSGTYECVAINNSGEARCEAPLLVQPLEQKDKPKSKPSGKEQAPTIT
QPLSGQVIHEGQPVTFSCKISGQPPITVKWQKGDKVIKPSKYFRMTQDGETVSLHISEVF
PEDEGTYKCLVSNAGGQAVLSANLKVIVPENQDVAPTLSPMRDVIVPEGNAAQFRTQVSG
QPSPSVQWFREGTLIPETPDFKMMYEGNMAVLLITSTYEEDSGVFTCRATNSAGQVETSA
KLTVKRQRGVTYKTGTFDDKGVVDSVQLNQVLGKTKEIGPQISLKNIKNDKKGLETSNNL
LPWRKGTVIDRIRKTSVEAKSIITENVIIEPTEIGDLITVTQEGTFIYTYVTEQIFTLIQ
NKIDTKDVEKAKQIINQILIKKMKQGDIVSLNENDKKEIVGEVTNKLTQLYTKKVDNKSF
AKDILNKVLTRSMEKEQQIQPYISEQQKKDETFVTTTEVIFKNKNKSQKDSKLTEEIIEP
RKLKIDKHEPQSEDNIFPNQKHQSKFYFGEEPTENYDIVPDEYKPKLKLESIENKEAKGQ
HNEKQKYNTRPWLIKYNKDTTSQETNYSPREETSNNEMDTSKEDLETKGQRKNNIPWTQE
KVTLKKTTIEKQVLTKEKIEDVLLKPLKFNKEDAKIKEYSPLMISTNDEVKPTIEEVNDT
PRDDTKTKPNKMPAIPWKEETVTLKKTKTQKQPLPKESVEEVTLKPFKKPVVEETAVTEE
SPETDTTEIVETVVEKVGKRRVRKTKTDVKGEVQESDEIIEEQKPTIEEVEDTPVELIST
EQERKPSVPWREETVTLKKTKTQKQPLPKESVEEVTLKPFKKPVVEETAVTEETPETDTT
EIVETVVEKVGKRRVRKTKTVVKGEVQENDEIIEETKPTIEEVEDTPVEGIPTEQERKPS
VPWREETVTLKKTKTQKQPLPKESVEEVTLKPFKKPVVEETAVTEESPETDTTEIVETIV
EKGGKRRVRKTKTDVKGEVQESDEIIEEQKPTTKEVEDTPVEEIPTEESPETDTTEIVET
VVEKVGKRRVRKTKTVVKGEVQENDEIIEETKPTIEEVEDTPVEGIPTEQERKPSVPWRE
ETVTLKKTKTQKQPLPKESVEEVTLKPFKRPVVEETAVTEESPETDTTEIVETIVEKGGK
RRVRKTKTVVKGEVQESDEIIEEQKPTIEEVEDTPVEEISTEQERKPSVPWREETVTLKK
TKTQKQPLSKESVEEVTLKPFKKPVVEETAVTEESPETDTTEIVETVVEKVGKRRVRKTK
TDVKGEVQESDEIIEEQKPTIEEVEETPNEERKPTIKELDVTPVEEVSIEQQRKPSVPWR
EETVTLKKTKTQKQQLPKESVEEVTLKPFKKPVVEDTPVTEESPETDTTEIVETIVEKGG
KRRVKKTKTVVKGEVQESDEIIEEQKPTIEEVEDTPVEEISTEQERKPSVPWREETVTLK
KTKTQKQPLPKESVEEVTLKPFKKPVVEETAVTEESPETDTTEIVETVVEKVGKRRVRKT
KTDVKGEVQESDEIIEEQKPTIEEVEETPNEERKPTIKELDVTPVEEVSIEQQRKPSVPW
REETVTLKKTKTQKQQLPKESVEEVTLKPFKKPVVEDTPVTEVSPETDTTEIVETIVEKG
GKRRVKKTKTVVKGEVQESDEIIEEQKPTIEEVKDTPVEEISTEQERKPSVPWREETVTL
KKTKTQKQPLPKESVEEVTLKPFKKPVVEETAVTEETPETDATEIVETVVEKVGKRRVRK
TKTDVKGEVQENDEIIEETKPTIEEVENTPVEEIPTEESPESDTTEIVETVVEKGGQRRV
RKTKTDVKGEVHESDEIIEEQKPTIEEVEHTPVEEIPTEQERKPSVPWREETVTLKKTKT
QKQPLPKESVEEVTLKPFKKPVVEETAVTEESPETDTTEIVETVVEKVGKRRVRKTKTDV
KGEVQESDEIIEEQKPTTKEVEDTPVEEIPTEESPETDTTEIVETVVEKGGQRRVRKTKT
DVKGEVHESDEIIEEQKPTIEEVEDTPVEEIPTEQERKPSVPWREETVTLKKTKTQKQPL
PKESVEEVTLKPFKKPVVEETAVTEESPETDTTEIVETVVEKVGKRRVRKTKTDVKGEVQ
ESDEIIEEQKPTTKEVEDTPVEEIPTEESPETDTTEIVETVVEKVGKRRVRKTTTVLKGE
VQENDEIIEETKPATKEVEDTPVEEIPTEQERKPSVPWREETVTLKKTKTQKQPLPKESV
EEVTLKPFKKPVVEETAVTEESPETDTTEIVETVVEKVGKRRVRKTKTDVKGEVQESDEI
IEEQKPTTKEVEDTPVEEIPTEESPETDTTEIVETVVEKVGKRRVRKTTTVLKGEVQEND
EIIEETKPATKEVEDTPVEGIPTEQERKPSVPWREETVTLKKTKTQKQPLPKESVEEVTL
KPFKKPVVEETAVTEESPETDTTEIVETVVEKVGKRRVRKTKTDVKGEVQESDEIIEEQK
PTTKEVEDTPVEEIPTEESPETDTTEIVETVVEKVGKRRVRKTKTNVKGEVQENDEIIEE
QKPTTKEVEDTPVEEIPTEESPETDTTEIVETVVEKVGKRRVRKTKTVLKGEVQENDEII
EETKPTIEEVEDTPVEVIPTEQERKPSVPWREETVTLKKTKTQKQPLPKESVEEVTLKPF
KKPVVEETAVTEESPETDTTEIVETIVEKGGKRRVRKTKTVVKGEVQESDEIIEEQKPTI
EEVEDTPVEEISTEQERKPSVPWREETVTLKKTKTQKQPLPKESVEEVTLKPFKKPVVEE
TAVTEESPETDTTEIVETVVEKVGKRRVRKTKTDVKGEVQESDEIIEETKPTIEEVEDTP
VEGIPTEQERKPTVPWREETVTLKKTKTQKQQLPKELVEEVTLKPFKKPVVEETAVTEES
PETDTTEIVETIVEKGGKRRVRKTKTVVKGEVQESDEIIEEQKPTIEEVEDTPVEEISTE
QERKPSVPWREETVTLKKTKTQKQPLPKESVEEVTLKPFKKPVVEETAVTEESPETDTTE
IVETIVEKGGKRRVRKTKTVVKGEVQESDEIIEEQKPTIEEVEDTPVEEISTEQERKPSV
PWREETVTLKKTKTQKQPLPKESVEEVTLKPFKKPVVEETAVTEESPETDTTEIVETVVE
KVGKRRVRKTKTDVKGEVQESDEIIEEQKPTIEEVEETQYEERKPTIKEVDVTPVEEVSI
EQQRKPSVPWREETVTLKKTKTQKQQLPKESVEEVTLKPFKKPVVEDTPVTEESPETDTT
EIVETVVEKGGQRRVRKTKTDMKGEVQESDEIIEEQKPTTKEVEDTPVEEIPTEESPETD
TTEIVETVVEKVGKRRVRKTKTVLKGEVQENDEIIEETKPTIEEVEDTPVEVIPTEQERK
PSVPWREETVTLKKTKTQKQPLPKESVEEVTLKPFKKPVVEETAVTEESPETDTTEIVET
VVEKVGKRRVRKTKTVLKGEVQENDEIIEETKPTIEEVEDTPVEVIPTEQERKPSVPWRE
ETVTLKKTKTQKQPLPKESVEEVTLKPFKKPVVEDTPVTEESPETDATEIVETVVDKVGK
RRVRKTKTDVKGEVQESDEIIEEQKPTTKEVEDTPVEEIPTEESPETDTTEIVETVVEKV
GKRRFRKTKTVLKGEVQENDEIIEETKPTIEEVEDTPVEVIPTEQERKPSVPWREETVTL
KKTKTQKQPLPKESVEEVTLKPFNKPVVEETAVTEESPETDTTEIVETVVEKVGKRRVRK
TKTDVKGEVQESDEIIEEQKPTTKEVEDTPVEEIPTEESPETDTTEIVETVVEKVGKRRV
RKTKTVLKGEVQENDEIIEETKPTIEEVEDTPVEVIPTEQERKPSVPWREETVTLKKTKT
QKQPLPKESVEEVTLKPFKKPVVEETAVTEESPETDTTEIVETVVEKVGKRRVRKTKTDV
KGEVQESDEIIEEQKPTIEEVEDTPVEEIPTEQERKPSVPWREETVTLKKTKTQKQPLPK
ESVEEVTLKPFNKPVVEETAVTEESPETDTTEIVETVVEKVGKRRVRKTKTDVKGEVQES
DEIIEEQKPTTKEVEDTPVEEIPTEESPETDTTEIVETVVEKVGKRRVRKTKTVLKGEVQ
ENDEIIEETKPTIEEVEDTPVEVIPTEQERKPSVPWREETVTLKKTKTQKQPLPKESVEE
VTLKPFKKPVVEETAVTEESPETDTTEIVETVVEKVGKRRVRKTKTDVKGEVQESDEIIE
EQKPTIEEVEDTPVEEIPTEQERKPSVPWREETVTLKKTKTQKQPLPKESVEEVTLKPLK
KPVAEDIPVIQEVADIQKIGSGINVVNNVVEVDTVFKEADVPAVDDQPIIKIRFLKHDDL
LKEDVAKKPNAIVCAQKVISVPKEKNKKNKKHVQLNEDMNQEKEFSPDDEVSALNDEEVE
VPSPKILDSKDLKGIMKPRDEIVSVPDVVLKDEEESIDTLAKPKNLTEQKVPIKLLGEKL
ELPWRKGRKDIDNDVTDIDIIDNTESHVPKKELMNVVELISQQPKSLEVNKPLFGTVQLK
KSSTKKINEIEPLAVPKVLLKSHIYRIDLNTNEHFPSTSLLEPIYVDNGVLSRNYAEAMK
IKKTKPKVLSLPDLEPVVLEKFEPTDFHYDKKETPERKPSLTKQSVDKKIPDEETPKKLI
IGKGKIPIQDDDQEKVILKKVPQKPVEEKLEMPKPIKKPHFKPEPDSKPSEDIDFTLEPF
KPITVGTSPEVSEPIPFGNESFPDVELPVKKPKYIRKKIKKEEEPIPDNKILPGTPRPVP
LDEEKDINLKYKQGKPEPELPDEIKLKPFLLEKPIDVKEPDDLNLGKPDVFDYPREEEQL
KPRDYKFKPEKKKKRPSKTVDIDKPIDDNNDSEIEPLPISKESPVLEEMVTIDVKPTKVV
AVALDNKPLLATIKLKKAPTKSKVDVDHVQIPKVLLKSHINNIEFNTHEHFPTTSLLEPI
YVDNGVLSRNYAEAMKIKKTKPKKLILPELEPVVLEKFEPTDFHYDKKEAPERKPSLTKQ
SVDKKIPDEETPKKLIIGKGKIPIQNDDQEKVVLKKVPQKPVEEKLEMPKPIKKPHFKPE
PDSKPSEDIDFTLEPFKPITVGISPEVSEPIPFGNESFPDVESPVKKPKYIRKKIKKEEE
PIPDNKILPGTPRPVPMDEEKDINLKYKQGIPEPEIPEEIKLKPIPIKKPLDNKETDDDE
LGKPKPFPSDFPKIDIHSKSKKSPSPKSISVDSPLQDLEIVSIKRSEEKPENKSIESEIV
APYFIEKVQPLVAEHEKPTAFTCSVGGIPTPEVKWYRDDRELQTTDVYEIIVYENTSTLR
ISKPTEEQAGVYVCQATNSAGISTCTALLVVLDSEEIGEAPTFVEPIKPRKVKGKKSIEL
RCIVKGIPIPEIIWCRENEEIISDDDEYRTSFDSKTGEAILTLVNPIEVDRSTYLARAVN
IHGKSECMAHITFEKEEYGEAPKFVERLKPKVVKANETTELTCLVKGVPSPSVVWCRDDE
EIIPDESHMLIYIPETGVSKLIIVHPDDIDESTYTVNAINKFGRAECRANLIVQKDELGE
APTFVQPVKPKIAKANEITELKCFVKGTPKPLVIWCRGNDEIIPDECHLVTYHQETGESI
LTILNPTEIDETIYTVNAVNKYGQAQCRANLIIQKDESGEAPIFVEPIKPKIAKANQATE
LNCLVRGIPTPTVVWFRGDVEIIPDTTHSITFIPDTGESKLVISKATEVDQNTYTVKATN
KYGRAQCRANVILQEDVFGVAPSFVEPIKPVLAKPDQTTVLRCLVTGNPMPTVVWCRGKD
EIVSDEMHTIQFISETGESTLTIEKPTTVDEARYSVEAINKFGRAICRANLVLEKYDTGI
APEFVIPIKPKAVKPTETVELRCVVTGTPMPTIVWCRGDEQIVPDDSHVVSYTPETGESK
LTICNATGLDVNDYTVKAVNDFGVAQCRANLIIDDVVQEIPIPLEEAPSITKPLEPVIAK
KDSCVTLDVHFRGTPELKVRWFHNGKDITDKKTFMRTLTITETTTVIIIKKITKKTTGRY
EVVVTNNRGEAKTSTTVLIEDEDDVEESIVPEEAVVGKAPYFETELQTETIWEEEEEEEE
TIIRLVVRVKGTPKPKIHWYENGMEITPSEEFEIEEQDEGVSVLMVKKRPTESVREITCE
ATNEYGTATTRTLIIPGIKGTKAYRKPSWVTQMEELREQLQAFQSLPSFVNELKDERAVE
NETIVFECQFSGNPTPVIIWYHDDKIVRNSPNVQVKITDTKTTLTIKRVTKEDEGVYICK
ANSNLGEAKNKSKLYVKKHGDETFTATEDELEEKEVEEVKKTKKTKKKATKKKHKKESEL
FDETETKESLRITTSKMVEEKPSLPEHEPLSTSETVSDETVKEVRGPEHVRPKTSEEPAL
FTALKVRKPAVVHEVDQVLDQVELAEFGPAEWPLRELATIDILTRHGISTEQVFEEYTSG
QFPALRTAPAQSAMVHLIEREGYTSLVADVFTKESTIPETVNEVFKAFMTMIELKHSTLE
EIITYLTPEDFQTSTWDFEHASQMTTDDTITDTADISESVNILVNEVKKKTRSTKKLVKT
SEETLSIDNEQVQNILDDRSVKITEIMDNSNVTIEVPEDRLIKTEKIIQQKKKMDDITVS
EDEEKEEIITAKTKTVKRIKVKRSITGEEIIPEETTYEFDVEKYPAICPTVLKTSKTLNE
TIAQQEAVELSTDYNNVPEKAQIRIITRNVAESIITKDEEKEENRKETLETKKHKANSVF
EFNESFSTDNPETQSPLEDICKTFEFIPCLAIKDIIPKESINIIEIYPNQSLGKGTEYNT
QNEKAKVTVISHSQKVVTELIASTKEGEIIQKCMPQKKKATQDYVEHESINVVEVNEAHT
ENQLQDVFKPTPVKSSVKYPLNEQLVVSELHSEIQPENYYPEIIVPTEIAKELIVPSNNA
ITTCQVEFSEKEEKYNRLKPPIEYKADISIIPEKYIEVSESNIQEKETKLEKQQIPEKSF
AISDIIVQSSIIVNSINQEENEEKFNTHIPQSHTAKLSINNANKVCSSSIIETNEAESDL
KILIVPEMKQIESSVFGLEVLDVTEIIPNETESNFTSESVLELLPDTSFTENNSCIVTET
TADDYSTDLLTNLNYKSYEVEPTFEELEAKQISQIDVQENDIPLDETPQPMSVKPETKFS
PIQSITVEQTILGEQEQLLLLKIQPELHNTVSVPSHSLQAVVIEEITPENCVTNLESTYK
DNNRHASKKAHINFVDDQCIIVKEISAYESESNLSLDSKPENVRAVPVFSGHDVAETIEI
ISNDAVEKLNIEKCKNNKAILKHIPYEAFMSEVTSVIELEDILLNKEKKQPKIVNITIDE
VIGVNITEQPVYEKEKMSSEQKVFKAKNAITEYVPIETFDRSEIVTGDYTLDLIQPEISK
LHAYHQPSTFESVILYETNISEKEKVMIDDKKPLPCSANTSLIVDEAIEVTEIISDNKPE
DIIISIVPKEETAETNIIPFKPLAGQDITTCENVETVTDNSPKTRVAHISQKAFHGLQTT
LIISTDSENKLSEFVMPNSKKAETNYTELDIPISVVEILTQDKELDFKANEIPSHTLDRQ
EIILEECRVTSETMVCSSTSDFDEFIPQSVYALSSKSTQIAIESIETAPLEKEGDLMDDN
ILSEKRADLAYEEVKSIQITEQVQLDTKQNLIIESIPMERKSNITITGQDAAETFQTKVE
SPVEELKIEFPKEKSAKTIQAKEVHGVEISEIITQETESSLDDTKPYNKKTVNILVEDNS
ASYMVTEIFPNEKEIQLIEQSQPIYRHAEQDILSHEGLQVNETNISICEKELSDFEYSIK
LGNQVIEPLKCIEISEVNVQEPEYNLFKSVHPKIENAIHSLEENVGLIINSIELIDKENE
LKIDKLNTKNATKVSNLIDYRVPQKSEKTTLECVKPLKDIKETVQQASSEHILLEGISTT
VVNLQDNEMPFEQSTKLNEKSASLEYEMEQTLNVTDVCIGESESDLIPTSLPRSHIAVSD
MSETQQVASSFEILSQNSTHNLSVQTLPSIISIIPKSTENHSFEVTETLYHETEIPFKST
ENALKTCCLTIQVDKNIVVTEIVTNESEKTLDLVELNKGSEANIVFDENQTVTIEEIETS
DDVAPLTESLSKPLSATKQLEPLLGILVTEVRSEESEIANEKQIQPLLKHVTQILPENQS
LNVTSTNLVEKESILNKPKQEIQQNAQTSLVFSPMKAVQLKENIIQMSLNNLKTTTPSEI
FIESTQIPYDSINQLEIRPFEKECEFKVTINQKKEVANINVDTINILDTTEIITGEKETV
YTPLTKPITRQAFIDITDTQPVSKVFEVKPEDSTSELITPNVTTCTVKPAQEIVHGVVIF
DNIGHDKEEIFEGEFRPPLTTAKIVVENEKETKTVTEVITQEMEGQVKNVELPSTKHAQI
EITSGKDIAEKTEILSNTALGSLKDFVTKSSTAVPVQDTFESIQSTITETEDKENPFYSN
LNYQKSKVDINIEQSKSVNITEVIVEDKEGKYISPEIPTAKTAGKSILPNEAAKASIVLA
NEHLRTLDKFKIKEELANIVLDTFKNISQTETTVQESEKYLEPIELLSNKAELTMIPNNS
LIITEVVTDDKDDNLHIKNEQIPQQVITSLSKLHEVPQVSEIISSNTTSDVFVPVIKNDH
AFISHSELYNMAISTEIKTLEKEKLFAQKPKLDIFKAEIKLNEDKSLNVFETVLNDKELP
LTIKKPFEKQASLTQSLFDVVTISEHIVNESEMNLESMIVPEVQKVDISFEDNINVQVTE
ANIVDTEIDLLTPIQNTEIATVPKLITQPVANVTEIITSMNVQELTQLSQPEYSIASANH
STFKSILQTEIDIAESEGILEKPRCIKEKASVKTETLENIIITEPEVSEKEEPLEESRKI
DLRHAELVLEEIKSSIIISNVASEDKETAFAEGPKRKHSVAKVVSENLQVITNSEQNVSE
KEGTLIIELPKDETANISFENSQSGIIVSDIIPEIKEENLKIKNTSYSTAKFVTENYESL
IQNEQTVNEKEQLRRSEQKPEITNASISIEKPNIGAVVSEVISHDKEIDFHKPQVRKMSK
ASISTEELKPLVTTETQLLSNIEELKVQKILPDNTANVKLEEFRHLTVHELVTNETESKI
KEINQIQCNIMPTVNEKMILESTVNLKQEAIDHHRASITEIPMSTGEFVNNILKEELSDE
LIESPLDSHTSKPMGEPTIIDKIDTTPFKEVDIKEAFSTLKPRKKKSISDEDEIVSVTFI
PKQTKPNEIIEQEFSIKAQTYEEEEISMTGNVKLHRKSVLDEPIKSLTINEINEIEFQPD
DLIKKLNEQSSHDEDVQPYSPIENIIKPVEQTFDKVITDQAATETPKRISNQLETDNVEH
EPSSKPSIMKDEAVDGITIEQIETIVKEEDQPTEDVEVELKPKRKTSLKKETKEKSLEQS
SVLLKRPKKKEEIPRTLEEQEEVFTFKKTIEKPEDVQPISETVDVEIEPKRKPSVKNEEA
ADEITIEQIETIVKEKDRPTEDVEVELKPKRKTSLKKETKEKSPEQSSVLLKRPKKKEEI
PQPLEEQEEVFMFKKTIEKPEDVQPISETVDVKIKPKRKPSVKKEEAADEITIEQIETIV
KEEEQPTEDVEVELKPKRKTSLKKETKEKSPEQSSVLLKRPKKKEEIPQPLEEQEEVFTF
KKTIEKPEDVQPISETIDVKIKPKRKPSVKKEEAADEITIEQIETIVKEKDQPTEDVEVE
LKPKRKTSLKKETKEKSPEQSSVLLKRPKKKDEIPQPLEVQEEVFTFKKTIEKPEDVQPI
SETVDVKIEPKRKPSIKNEEAADEITIEQIETIVKEKDQPTEDVEVELKPKRKTSLKKET
KEKSPEQSSVLLKRPKKKEEIPQTLEEQEEVFTFKKTIEKPEDVQPISETVDVKIKPKRK
PSVKKEEAADEITIEQIETIVKEEEQPTEDVEVELKPKRKTSLKKETKEKSPEQSSVLLK
RPNKKEEIPQTLEEQEEVFTFKKTIEKPEDVQPISETVDVKIKPKRKPSVKKEEAADEIT
IEQIETIVKEKDQPTEDDEVELKPKRKTSLKKETKEKSPEQSSVLLKRPKKKEKIPQPLE
EQEEVFTFKKTIEKPEDVQPISETVDVKIKPKRKPSVKKEEAADEITIEQIETIVKEEEQ
PTEDVEVELKPKRKTSLKKETKEKSPEQSSVLLKRPKKKEKIPQPLEEQEEVFTFKKTIE
KPEDVQPISETVDVKIKPKRKPSVKKEEAADEITIEQIETIVKEEEQPTEDVEVELKPKR
KTSLKKETKEKSPEQSSVLLKRPVKKVDKSNEIDQHEEVFTIKKTPEQSMLLNEEFSETV
EFKMKPKRNSSVYNIDEGTEELFQIELKPKKELQDIKIYEEESLDFKVKRKPSLHSFSQD
GAELKIIQEKEIFVKDNSTLQEDSHDGEIMFAIRSYIAENEDALDLVEGEKVYVIESNNQ
DWWFVKKHLTEEKGWVPSIYLRDETSYMRYVQKKLHEKIDKLPIFQRHASTEKPSAPRFV
EKLQPKHVQDGGTVQFECHVEGNPKPQITWFRQTAIIKPSQDFQIFYDEDNVATLIIREV
FPEDAGTFTCVAKNVAGFASSTTELTVEAPLSDHGSDVTGLSRKSMSRESSLADILEGIP
PTFSRKPKATCASEHSDVTIECRLVAVPEPDIFWHYNGKEISITDSIKVNTYSDMHFYVS
CIKINDVLKTQEGVYSVIARNREGEAKMDLVLKVKTGLPEKPQILEPLYDITINEGETAV
LSTQISGEPQPMVEWLKNSKKITDIKTVVTKDGVHSLTIDNPTPRDSAKYTVIASNKLGN
AQTMCFLAVEELPGPQAPLFIERFQEQTVKEKGTITLIAKVTGNPVPIVSWFRNNKPLLA
SSKKKEVFDGENIVLEIVNADSEEDAGDYKCVASNTFGTATHGARVSVDVPLVKFTRPLT
DVEVDEKQSIYLECETSHTVSTKWQLNGKDLTGMDHRELHQEGRFHRLIIKKSSILDSGK
YTCLVKDQITSSTVVVHDVKAEFVKKLEDVEVKENDCAIMEVEVSSETVNVTWHKNGEML
TDGMNNKVFFEKEGQIRKLIIRSISVHDDGEYTCSLGEQECTAEINVIELAPQIIKKLKD
QKVATGEQVLFEIELTKGDALVKWTKDGKELQLNNNVRLTIDGKRQKLEIVKATKTDTGV
YGCQVHEQTCTAKLTVEEPRASFVKKLPDITLAVQGSDIKLTVELSKPDVPVKWLRSGKV
IKESDKYEIISEGAVHTLIIKKPTTDDEAEYICTAVNVKTSTKLKVEVKEEAPKINNLPK
EYRLKNGEDLNVDVTFTSTPLPTVEWFINGSVLIKTNRVSYSISESSASLTISKIEEVDT
GVLTLKLKNTFGETTADMNIIVIKVPGEPGVPDVIEVTDTSVTLHWKPPQFDGNSPIEGY
VVEYHDKDEFMVWHKVQVTDTTHEVTSLVTGHEIMFKVAAINCAGIGPSSHNTKYIKMAS
PGSFTPPVIQEPLSDLSIGMGKSAVLQCVITGKPTPDIKWLKNKTLYKTKSASFENHVAK
LTFAECNESTTGTYTCQATNGAGTAQTSCKLSVQDVPKIEVHESETSQMIRVRNQWKVKA
TYKGYPKPTISWQKNSQPLPVADKHISVYDDNDEWSSTIAIYSAERPDTGVYTITASNSA
GTATCNLNLKVIDKPSAPQGPMRIKEINSDSVTIEWNKPSDDGGLDISAYQVERCNVGKM
IWSKVADVDHDVSAYSVQKLHEDAEYMFRVCAQNAVGASDFLDSEPVTVKCRYHKPSAPQ
GPLQITGVTDTSSTIAWLPPLDNGGIAIEDYCVEIKEVDKKAWRKIGSTKDLHIKLLDLK
KGSSYDIRITARNHVGYGKPYQPDEPIVAGKRINFRNGISDETLYVLMGIFPTRPKVSAS
PSPPTEFTVSDITSKSVTLHWGPPESNGGSDITGYVIEKQLNTTNKWFKVATLEPTVMKY
CVENLKEKSEYFFKIYAENCIGLSQPVETKLVSLLTHATVPSPPTAPLEVRNLSTNAVIV
EWGVPETDGGAPLLGYNIAIRDEKKTMWMEVGRVEADVQKFNIKDLQENHRYQIRILAKN
EVGVSEPLETEEPYTVQKPTEYYESDVEESVMESKPSLTQTSETTTSWLRDNNMDADISS
YSNAALLKRSEYFFRIWYYARTLFK
NT seq 50118 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgacaacatcaacaacaacaacaacaacaacaacagattaccaccaccaccacc
tcatcgttgtcaaacacggggcagaggagcgtgaatcgtaccgaacaacaggtcacgaga
caattcacgcagaccacacaaagacaagttcacgaagggtttattgtacagcagtctact
ccaaaatttggaaatgacgctgctccgccagtatttgaacagatattcaaaaacgccaga
ttcgctcagggtggaaatgccgtttttgaaggaaaggttaccggtattccaaaacctttt
gtctcgtggaccaggaaaggcgctccactattggagtcaaacaaatacaagatgacgtat
gatcaacaaacagggaatgttgttcttacgatcaatcaaatcgggccaggagatgaaggc
gaatacacatgttcggcgcgcaatcaatacggcgaagcaatttgttctgttttcattcaa
ccagaaggtcatacagttcaaatacctcaaggcacgtatggttcgcagcgagtacaacag
acacagaatacgctgtatacaaataattattcaaacatcgatgaagatttcaaagtcgat
actttcgaatatcgtttacttcgtgaagtgtccttcaggcagtccgtcaccaagaggtat
ctgggtgaagaggacgtcaagtttacaagcagcgcacaccaaggcccggtagtagcacct
caagtgctccagaaaccgcgtaactcgaaattagtagaaggatcgaacgctacgtttact
gtaaaagtgtcaacagctaaggatactaggttgacttggtttaagaacggccagagactc
gtaaacggaccaaaacaccagatcaatttcactaatcaagtcgctacactttccatacca
caagtttgttgtgaggattctggacattacactctgcttgtagaaaacccacaaggctgt
gtagtatcttctgcatatcttgccatagaaccgacgtcgatagcatatgatagaacagaa
gacaaggaaaatgtaataactaagactcacaataagctcgagtcgatagaagtggttgag
ggcaaaatgttagcgccaaactttgtgcgtgtatgtggagatcgtgacgtgaccgaaggg
aaattgacacgtttcgatgttcgcgtaacgggcaaaccgtatcccgaagtctcgtggtat
ataaatggtcagcaaattaaggacgacgcaacgcacaagatactggttaacgaatctggt
gaccacggtttgatgataactaatgtgtcccaagctgacgcaggtcaagtggtttgtgtt
gcaagaagtaaatctggagaaacttctttccaatgtaatttgggagttgttgaaaaagaa
cttgtagtttctccaaagtttgtacaacgttttacacctttaaatataaacgaaggagaa
acagttacgttgagtgtcagagctgttggaaccccagtaccaagaataacatggcaaaaa
gatggtgtaaacatcagcgaacaaccaggaatggtatctgtatggaccgaaggaggtggt
tcagtattagaaatagcaagagcttctccaacagacgcaggttggtatcaatgtacagct
caaaacacagctggatctacagccacacgggctcgactaaacatcataaggaaacctcgc
cctgaagatttctccgaagaccgacgtctcaggttgccaaaaccaacacgagtaatcgaa
cctgagcctgagccagaaccagaagttgtttttctaaaacatgtcgagagagcaaaatac
catactcctcgaccagaagaagacaagatttatccaccgccaaggttcattgttccgctt
gcaaacatatctcaacaagaagatggtcgaattcattttgaggctagaattgaacccatt
ggagatccaaccatggtggctgagtggtttgtaaatggttatccattacaagcaagttct
agagctatgactttactaaattacggtttcatagctttggatttgttgagcattgtatca
gatgatgctggagaatacacatgtagagtaaccagtagctcgggaacagctcaatctact
gctgttctcaaagttgaagggagagatgaaattgataaatcaagtcaatatccagacagt
ttaaaatatattgaacaattggaagattattccaaatatcaaagaagtgatagttacgat
gaagttcagccattaccacccactttagttaaatcattacatgatatgggtaatttacaa
gagggtagaaatgcacatttcgaagctcagcttaatccagtcagtgatccaacaatgaaa
gtagagtggtataaagatggaaaacctattacagcaagttcaagaataacaacaatattt
aattttggttacgtatcgttgaatattatgcatcttcgtgcagaagacagtggagaatat
actttaagagcaataaaccgatggggagaaattatcagcacatcgacattaaatgtcatt
gctcatagcagtattacaggcgatttaggctacccagaacagcaaaggtatattgatcaa
actgaggctttagaacaatcttacctacaacaaaaaaatcaggaatataaaataagtgca
ccagaaagtgttgcaccaccacaatttaaaacaccaattaaagatcaacaaaacattaaa
gaaggtggtttcgctcattttgaagcaagattagaaccattaggagactcgacacttcaa
gtagaatggttaaaggatggtaaaccagttgaagctagttcaagaatgactgtattcttc
aactttggatatgttgcattaacaataaaatatgtaactgtttttgatattggaacatat
acttgcagagcttataataatttaggagatgcttcgacatctgctacattaactgtgcta
actagaaaagatgttgtacaagatagccaacaccctggaggtctcgaacgattccaatat
ttggaagattcaagaaagaataaacgaaaggcagaagaagaaacagttgttacacaaaaa
cctagattccttggaccgttaaaaggaacaaataaaattgctgaagggcaaagagctcat
tttgaagtacgagtagaacctcaaaatgatgtgaccatgaagattgaatggtatttcaat
ggaagagtaataatgagcgctaatagaattcaaacatatcatgattttggttatgtggct
ttggatattcttggtgtaagagcagaagatagtggtacatatgtagttgttgcaaggaat
gcattaggagaggcccagctgtcatcaacaatgcaagttgaagttcgttcaaatattgat
acatctactatgcatcgtggagtagtcgaaaaagctccttatcttgaatctaaaaagttc
actgaacctcagtatgatattgaggaaatttcgaagtcgagacctatatttatacaacca
ttaagcgaccctgcaccattgaatgagggaaaaaatgttcatttggaatgccgtcttgag
cctatgggtgatcctacgatgagagtcgaatggttccaaaatggaaaacctgtaacagtt
ggttcgaggttccgtacgtattatgattttggatatgtggctttggatatcatacatgtc
acgtcgatcgactctggtgaatacactgtgagagctacaaaccatttaggatcagctcat
acatctgcatgtgtcaatgtattatgccgatcagatattttaactgaaagtcaaaatgag
tatgcgttagagcagatacaaatgttagaagacgcttcaagataccaaaaaatgactacc
gaagaagaaagtattatgcaagcaccacagttcacaaaaccattacataatatacagaca
tctgaaggtacaaacatacatttggaatgtagattaaaaccggttggagatccaactatg
aaaatcgattggctggtcaacggacgtccagtaaaaacaggacataggttccgccctgcc
tatgattttgattatgtagcattggatttattaagtgtatatcctgaagattccggagtg
tatacttgccaagctagaaatgaaatgggtgaagctgttacctccagctcagtgaaagtg
attgcaaaacagaatttaatattagattcacaacatccacatggtctggaaaaaatacaa
tatctagaagattcagctagatacaaaaaggctgaaatgattgaagaatctgttaaaata
aaacctcgttttttgtccaaaccaaagaatgtggagaatttaaaagaaggacagcatgct
cattttgaatgtaaattagaaccagtcactgattctaacttagaagtccagtggtttaaa
aatggaaaaccaattattattggccatcgctttagacctatccatgatttcgggtatgtg
gccttagatatcatagatgtcattgaagaagacactggaacttatacgtgtcgggctgtt
aatttacttggcgttgatgaaacaaatgttcatctaacctgcagaagttcgtcaggtatt
gtaacagatactcaaaatgaaatgggtcttgaacaaattcagtatcttgaagaaaaatct
aggtacaacagaagagaagatattgaagaaacaaccactcaagccccaattttcactact
tcgttgaagcattgtgatattaaggaaggccaacgagctcattttgaatgtagattaatc
ccagtatctgataacaccatgaaagttgaatggttccataataatgtcccaattaaattt
ggatcgcgatttactgaaactaataactttggatttgttgcattggatattcttcaatgt
ttacctgaagattctggcacatacacatgccgtgcaactaattggctaggacaatctatt
acatcaggaaatctcaacgttcaatcgagaaagtcgatttatttggaatctcaacacgaa
gatgcattaggacgtttagctcagcttgaaaactcaaaccgttatcaacgacaatcaatt
atagaggatgcagtaacacaagctccagtatttactcaacctatgagagatagtacaatg
attgaaagtcagcctgctcattttgaagcaagattaataccagtgggtgatgacaaatta
aaagtagaatggttaagaaatggaattcctattcaagcatctaatcgtgtatcaacaatg
catgattttggttacgtcgctcttaatcttaaatatgtctatcctgaggattctggtact
tatacatgcagagctataaatgatttaggacaagcagtcacctcagccacactgaatgtg
cattctaaagcttctcttcaattggaaagtcaacacgaagcagcattagataaattaaga
cagctcgaagattctaataggtacaagcgtacagaacaaaaagaagtagaagttactgag
gcacctaagtttattgtgccattaaatggaactgaaagtttaattgaaggtcaaagtgct
cattatgaatgtcgtatagagccttatcctgatcatacactgcaattagaatggttacac
aatgggaaaccattacaaacaggacatagatttagaacaacttatgattttggttttgcg
tcattggatgttttatctgctttaccagaagattcgggagaatatacttgcagggcaatt
aataaactcggtagggccgagtcatcagttaagctaggagttcaatctcgagcatcgatt
attagtgatactcaacaccaaggagctttgaacaaaatacagtatctagaagatgattct
agatttaaaagagcagctgctgaagacgttttaatgacagagaaaccccaatttggacga
cctcttaaaaatatagaacatcttccagagggacgtagtgtacatcttgaagctacatta
attccagttaacgacccaactatgaaggttgagtggtatagaaacggaataccaattcct
caaggccacagatttaagacagtttatgattttggatttgttgctttggatgtactttat
gcttatcctgaagattcaggaacatacatgtgcaaagccaaaaatgctgccggagaagca
gtcactacttgcattgtaactgtcgattctaaatctggtcttcagttagacaccttggat
gaggatagattgaaaaagattaaacaacttgaagcttatgaaagacctacagctcaagaa
gctgtatttgaacttcaaaaaccagtattcctcacacctcttaacagccttgaattattg
aaagaaggagaacatgctcatttagaaactcgaattgaacccattaatgatgctgatttg
aaaatagaatggtttgttaatggagttgcaatcaaaacgggtcatcgttttaagactaca
catgattttggatatgttgcattggatattttgtatgcatatgctgaagattccggtact
tacatgtgtaaagccactaataaaaaaggagaagcagtaaatacttgccaaataaatgtt
gcctctcgtagaagtatctacttagaaacgcagcatcctgatggtttagaaaagattcgt
gaacttgaagcgcaaggacgcccagcaaaacttgaaatcaacgagcctccgccaacagta
ccaacattaaccgatctatggggcactactgaggtagctgaaggaaaaacagcccacttt
gagtgtcaagtaaaacctatccacgattctaaattgaaagttgaattcttccataatgac
aaacccctcggatctgcttctcgtttccatactacatatgactttggttacatatcttta
gatattggccatgttgttcctgaagatgctggaaagtacactgttaaagctaccaatgaa
ttgggtcaagctacttcaaatattaatttattagttcaaggaggtggaagtataattttg
gactctcaaagacctgaaggattagaaaaaataaaagagttagagatggctgtacctttc
aaacgtgcagattattcagaacctatatcaaaacaaagaccaatgtttacacaaccttta
caaaatattgacagcataaatgaaggacaaacagctcactttgaatgtcgtcttatccca
attggtgattcttcgatgactgtcgaatggtttagaaatgaaaaaccaatagaaacaagt
tcaaggattacaaaaacatatgactttggttatatatctttagatatttctcatgtaaga
gatgaagataatggggtatatagttgtaaagccacaaatgctcttggtgaggcggtttca
acagcctctatgagagttagaacaaaatctgatattcagttagagagtcaacatccagaa
ggtcttaaaaaaattgttgaattagaacgtagtcaagagccattgaagagagaagaggca
gagagatcatttgagaaaccgattttcacacaacttcttacaggcccttcagagcttatt
gaaggtcaacatgctcattttgagtgtagagttgtaccagtaggtgatccaacattacgt
ttcgaatggtatgttaatggagtcgaattaaaaatgggttcaagattccaagtaacaaat
gattttggctttgttacattggatatcagctcaactgttgcagaagattctggagtttat
acatgcaaagcaattaacagggctggagaagctgtttcttccacttcaatgaaaataaaa
catcgctcatcaattattcatgaaccaattcaacctgatgcatgggaaaaaatccagctt
aaagaagcagaaatgaataaagttcctgaaatgtttattgatacaagaccacaacaagca
cctgtttttacatcacatttgcaaaatcaagaccgtctagctgaaggtcagcatgttcat
ttagaagctcaagtagaacccagagcagatcctaatcttcgaattgaatggttcaaaaat
ggagtcacattaacgactggttcaagaatacgcagcacttttgattttggtttggtcaca
ctagcaataaatagtttgagaccagatgattcagctatctatacgtgcaaagcatcaaac
cttttgggtgaagctgtttcaacttgtacattaaaaatatccgatagccattggttatta
agtaacactttacaccctgaatcactatcaaaaattgaagatttggaaaaaccacatgct
ggacaagttgaaggcccagaaccagtttttgaaagtcctgttttcatttctcatcttaat
aactgggaatgtaaagaaggaagtgatgttcattttgaatgtcaagtagaaccttctaaa
gatccaactttgaaaattgattggtttgtaaatggaaaaccacttcaaagtgcagcacga
ttcaagtctgcctatgattttggttttgtgacattagacatacatcatgcatactcggaa
gattctgggatatatacttgcaaagctagtaatagcaaaggtcaagctgtaacaactgga
acattaaaatgtacaggtctccaaggaattcatttagacacacaacatccacaaggcaaa
actggattagaaaaggtacaaaaagtagaagataatttagcttctaaatatcaacgtcaa
gcatctttgcctgaggctgctttcccaaaaccaatatttgttgtaccccttgaagctgaa
ttcatattagccgaaagtaaaccactgcatttggaggctcaagttgaacccaagaatgac
cctaatctcaaaattgaatggtactttaatggaaaagtacttgatttaggatcacgcttt
aagacaaacaatgattttggttttataagtttggatttaactgatgtgtatgaacgagat
caaggagtctatacctgcaaagcatataaccattctggagaaacatatacttcaacaact
gtgtattgcagtagcaacaaaggattaattgaacatactcaacacccaaaaggagaagaa
ggcttggaaaaaattcaaagcttagaagaatctctacaaaggcaaaaacaaggaattacg
gataaagagactgggcatgcacctgttttcacttcacaattcaaagaccttggtttctta
agtgaaggtgaaattgctcattatgaagcttcattaacacctgttggtgatcagaaaatg
gttgttgaatggttctacaatggaaatgccatcgaagctagtcaccgtattcgtacaatt
tatgcatttggaatggttgttcttgaaattcttggtactaaaatagctgatacaggaaca
tacacttgtaaagcaacaaatgattatggatctgcagagatgagtgttacactagaatgt
gtagaaagaataactggtcaaaaaccaaaattcacatctcaaattcagactcttgttggc
ttaaaggatggagattctgcacattttgaatgcacattaatacctgtcaatgacccagat
ttaaaagtagaatggttccacaatggtcaaccgttattacacaaaaatcgcgttaaaatg
atttccgattttggatttgttgtcatggatatagcatatatacaaaaccacgattctgga
gaatatgtgtgtaaagcaagcaataagtatggtgaagatataactaaagccactatccaa
tactctggaaaaggtggtgtgtatttagattcattgcaacctacttcattagctagaatt
catgagttagaaaacgcaacaggtcaaccaagtggatttgcatcatctccggtattagaa
gctcctaaattcacaactcaattggttgacataacaaatttgaaagaagggcaaagcgct
cactttgaagctcgagttacaccagtgaacgatccaaatcttgttgttgaatggtatttc
aacggtgaaaagctacagcatggtcataggtttagaacattccacgattttggtatagta
atattggatatactgtattgctatgaagagaattctggagtatatgagtgtagagcattc
aataaagcaggaactgatactactaaggcaaatcttcgttgttcctccaaaaccaatttg
atcttagattctcaactgcctcgtggaatggaaggaggattagaaaaaatacaaactctt
gaagatttaactctcagagttaaagatgaaagagtatctgtggaaaatcgccaagctcca
atgtttactgaaccattatccaatattgatagtctacgagaaggtgaaagtgcacatttt
gaaggtcgcctgacacctgttgatgatcctaacttaaaggtggaatggttctggaatgga
aaaccattaaaagctggttctagatttaggactttctgtgagtttggttttgttatattg
gaaatatctccagtatatcctgaagattctggagaatattcatgccgagcttctaaccat
tttggtgaagctgtcactacagccagcatgaaagttcaaggaaagagaagtatcatattt
gaatcacagcttccaaaaggaatggacactactattgatagaattgcagagcttgaaggt
cttggaaaatcaagggcaactattgaaactgaagatgatctgggaagagcaccagaattt
attacaaccccagctgatcttagtttgtcagaaaattcgttggctcattttgaatgcagg
cttgtaccatccaatgatgcaagcatgacagttacttggttccataatggcaaagtatta
tcggccggatcacgtataaaaacaatcaatgattttggatttgttatccttgaagtagct
ggtgtttatattagagattctggtctatatacttgcaaggctatcaataaacatggagaa
gcaacagtatcatgtaagttacaagtaaaaggccggcaaggtatagttttagaacctcaa
ttgcctaatacattcagatctggtacaaaaagtattcaaaaactcgaagagaatatgtat
aaaaaggaagaaatattggctgaagatgaaaaaccaaatcctcctaggtttactgtagaa
ttgaaggatgcattggatgttcaagaagccaaatccgtacattttgaatgtagagtagaa
cctgttaatgattctacattacggatcgattggtttttcaatggaaaacctttcgccact
ggctcacgtgtacatgtgataaatgattttggatttatatctttggatatggactatgtt
tactctcgagattctggcgaatatatatgtcgtgcaacaaacaaatggggaactgctttc
actaaagcaaaattaacttgcactgccaaacaaaatgtcatattagaatcacaattacca
gatggaatgagtggagaaaagttaaaagcgttagagcaagggcctgtacaagaaaaaaaa
attcatgatgagatagaagcaatgccaccaaaattcttagctcagattgagtcaacaact
gtcgaagaagcaagttcggtgcattttgaaactagagtcgagcctaaaaatgatccaaaa
ttaagagtagagtggtacagaaatggaaaaccattaccttctgggcatagatacaaatct
atatttgatttgggtttcgtctctttggatatactttctatgtactctgaagactcagga
gagtacatttgtagagctgtaaatgatcacggtgaagctattaccaaagctatggtcaca
tgcaaacagctcccaacaatattacttcaaaatcaagtaccaaaaggtatgaaaaaatca
gaggctttgactcaaatggaagcagctattaaaaaatacacatctgagattcatttaacc
atagatgatttgtatgaagttgagaagaaacaaccaccaaggtttgtcacccaaattaaa
gatcagttgtcgttagttgaaatggaatcaaccaaatttgaatgtcaattagctccagtt
ggtgatcctaatatgaaggttgagtggttcttaaatggcaaaccactaagacacaagaat
agatttaatccaatttatgattttggttacgttgcaatgaatttcggttggatatatcct
gaagacagtggagaatatgtttgtagggctactaatttatatggccaagatgaaaccaga
gccactataaaaacgtctggtaagccaggtatcatttatgattcacagcttcctaaaggg
atgaagagcattgaaaaaataagagaaatggaagcatcatggcaagtaacacctgaaatg
aaagaagaagaagaaaaacgtagagaaccgccacaatttgtaagcaaaccggaacctgtc
actatatgtgaaggtgattgggctagattctgttgtagagtcactggttttccgagacca
agagttatgtggctagtcaatggaaatactgtggtcaatggaatgagatacaaattaaat
tacgatggaatgtggcatcttgacataccaaagacaagacaatatgaccatggtaaagtt
gaagttattgctagaaatgcatgtggagagactcgtgtggaaacaatgctcacagtaaat
tcaagacatgatgattacagaggagttttgaaaaactcacctagaccatggtacgacagt
gatttggtgcagtatcaaaaggatcttaaagagaatgaactagaaaaagtgtttactgat
agagcatcaaatgttcaaaatgttgattatagtaatatgattatatcaacggtcggtgtt
caaatgaaacaaaaacaattaaatgagtcaaaacccgaatggactgaagctgtaaaacaa
aagaagaatgaagattattatagtaaattgagtaaattggaaggagatcaagtggtaaaa
gaggcaagaatcagagaagctagtcatcaagtatcattagcaggcgagaagttgaaaact
acatccaaaaatatgtcttcaaattacgaagaatcgttagagaaagataaaaaagaagaa
ctaatgccttggcaaaaaacaaagttacttaaatcacggggtgatcagagtcaacaaata
ataccggacccgtctgagtcttcggtgcatggaaaagaaattcacgtagcaaaacagcaa
cagacacaaaaagaaatacaaggcgacaaagaaatacgcagaaaaattactgctaccgaa
accactgaagtagaacacacacgcaaaaaccaagaaagggtagtccaaggaaaagttgaa
ccgtccaaaccgccagtatttacaaccaaaattcaaccctgtcgtgcattcgaacaggac
caagcgcgttttgaggtcgaattcgatggcgaaccattaccaacgatcaaatggtatcga
gaagactttttaatacaaaactcaccagatttccaaatacacacgtttagtacgaagtcc
atactaattattagacaagtatttatggaagattctggcgtgtttgccgtcatcgcggag
aacagaggtggcaaggcaaaatgcagcgccaatctacttgtcgaagaacgtaaacaagtc
ggcaggaaaggacctggtccaccgagtttcctcactacaatgcaaggagcagtcgtgaaa
gccggtcaactagtcaggtttgacgttaaaatcagcgctaataaaccactggatgtatat
tggttaaagaacggaaagaaaatcacccaggatattcgttacaaaacagtagacgaagac
aaccaatacacgcttttgatcatcgagtcagtcaccgaagacagcggaacctacgagtgt
gtggccatcaacaattctggcgaagcgaggtgtgaagctccgttgttagtccaacccttg
gaacagaaggataaacccaaatcaaaacccagtggtaaagagcaggcgccaacaatcact
caaccgttatccggacaagtgattcacgagggacaacccgtgacgttcagctgtaagatt
tctggacaacctccaataacagtaaaatggcaaaaaggcgataaagtgattaaaccttca
aaatatttccgcatgacgcaagacggggaaacggtatcactgcatatatccgaagtcttc
ccggaggatgaaggcacgtacaaatgtctagtatcgaatgccggtggccaggctgtccta
tcagctaatttgaaagtcattgtacctgaaaatcaagatgtagctccaactttgagccca
atgagagacgttatcgttccagaaggtaatgcggctcagttccgcacgcaagtgtcgggt
caaccgtcaccgtctgtacaatggttcagagaaggaacacttattcctgaaacaccagat
tttaagatgatgtacgaaggtaacatggccgttctgttgataacatcgacatacgaagaa
gactctggtgtgttcacgtgccgtgccacaaatagcgctggacaagtagagacctcggcc
aaacttacggtgaaaagacaacgcggcgttacttataagactggtacatttgacgataaa
ggtgtagtggatagcgtacaactaaatcaagtgttaggtaaaacaaaagaaataggtcct
caaatttctcttaaaaatattaaaaatgataaaaaagggttagaaacaagtaataattta
ttgccatggagaaaaggaactgtaattgacagaataagaaaaacctcagtagaagcaaaa
agcataattacagagaatgtaattattgaacctacagaaattggtgatttaatcacagtt
acacaagaaggaacattcatatatacatacgttacagaacagatatttaccttaattcaa
aataaaatcgatactaaagatgtagaaaaagcaaaacaaataattaatcaaattttgata
aaaaaaatgaaacaaggtgatattgtgagtttaaacgaaaatgataaaaaagaaatagtt
ggtgaagtaactaacaagttaacacagttatatacaaagaaagtagataacaaatcgttt
gcaaaggatatccttaacaaagtcttaacacgaagtatggagaaggaacaacaaattcaa
ccatatatatcagaacaacaaaagaaagatgaaactttcgtaacaacaacagaagtgatt
ttcaaaaataaaaataaatctcaaaaggactcaaaattgacagaagaaattatagaacca
agaaaactcaagatagataaacatgaaccacaatccgaagataatatttttcctaatcaa
aaacatcaaagtaaattttatttcggagaagagccaactgagaattatgatatagttcca
gatgaatacaaacctaaattaaaattagaaagtattgagaataaagaagccaaaggtcaa
cacaatgaaaaacaaaaatacaatacgagaccttggttaataaaatataataaagataca
accagccaggaaacaaattattcaccacgtgaagaaacttcaaataatgaaatggacact
tctaaagaagatttggaaacaaaaggtcaaagaaaaaacaatattccctggacacaagaa
aaagtaacattaaaaaaaacaacaatagaaaaacaggttttaaccaaggagaagatagaa
gacgtgttactaaaaccattaaaattcaacaaagaggatgcaaaaataaaagaatattct
ccactgatgatttctactaacgatgaagtaaaacccacaattgaagaagtcaatgatact
ccaagagatgacaccaaaaccaaacctaataaaatgcccgctataccatggaaagaagaa
acagtaacactgaagaaaacaaaaacacaaaagcaaccattaccaaaagaatcagttgaa
gaggtaactcttaaaccgtttaagaaaccagttgtagaagaaaccgcggttactgaagag
tctccagagaccgacacaactgaaatagttgaaacagtcgtcgagaaagttggtaaacga
cgagtcaggaaaactaaaaccgacgtgaagggtgaagttcaagaatctgatgaaatcatt
gaagaacagaaacctacaatagaggaagtcgaggatacaccagttgaactgatctcaact
gaacaggaaagaaaaccatctgtaccatggcgcgaagaaacggtaacactgaagaaaaca
aaaacacaaaagcaaccattaccaaaagaatcagttgaagaggtaactcttaaaccgttt
aagaaaccagttgtagaagaaaccgcggttactgaagagactccagagaccgacacaact
gaaatagttgaaacagtcgtcgagaaagttggtaaacgacgagtcaggaaaactaaaacc
gtcgtaaagggcgaagttcaagaaaacgatgaaatcattgaagaaacgaaacctacaatt
gaagaagtcgaggatacaccagttgaagggatcccaactgaacaggaaagaaaaccaagt
gtaccatggcgcgaagaaacggtaacactgaagaaaacaaaaacacaaaagcaaccatta
cctaaagaatcagttgaagaggtaactcttaaaccgtttaagaaaccagttgtagaagaa
actgcggttactgaagagtctcctgagaccgacacaactgaaatagttgaaacaatcgta
gagaagggtggtaaacgacgagtcaggaaaactaaaaccgacgtgaagggtgaagttcaa
gaatctgatgaaatcattgaagaacagaaacctacaactaaggaagtcgaggatacacca
gttgaagagataccaactgaagagtctccagagaccgacacaactgaaatagtcgaaaca
gtcgtcgagaaagttggtaaacgacgagtcagaaaaactaaaaccgtcgtaaagggcgaa
gttcaagaaaacgatgaaatcattgaagaaacgaaacctacaattgaagaagtcgaggat
acaccagttgaagggatcccaactgaacaggaaagaaaaccaagtgtaccatggcgcgaa
gaaacggtaacactgaagaaaacaaaaacacaaaagcaaccattacctaaagaatcagtt
gaagaggtaactcttaaaccgtttaagagaccagttgtagaagaaactgcggttactgaa
gagtctcctgagaccgacacaactgaaatagttgaaacaatcgtagagaagggtggtaaa
cgacgagtcaggaaaactaaaaccgtcgtaaagggcgaagttcaagaatctgatgaaatc
attgaagaacagaaacctacaattgaggaagtcgaggatacaccagttgaagagatctca
actgaacaggaaagaaaaccatctgtaccatggcgcgaagaaacggtaacactgaagaaa
acaaaaacacagaagcaaccattatcaaaagaatcagttgaagaggtaactcttaaaccg
tttaagaaaccagttgtagaagaaaccgcggttactgaagagtctccagagaccgacaca
actgaaatagttgaaacagtcgtcgagaaagttggtaaacgacgagtcaggaaaactaaa
accgacgtgaagggtgaagttcaagaatctgatgaaatcattgaagaacagaaacctaca
attgaggaagtcgaggagacaccaaatgaagaacggaaacctacaattaaggagttagac
gttacaccagttgaagaggtttcaatcgaacagcaaagaaaaccatctgtaccatggcgc
gaagaaacggttacactgaagaaaacaaaaacacaaaaacaacaattaccaaaagaatca
gttgaagaggtaactcttaaaccgtttaagaaaccagttgtagaagacactcctgttact
gaagagtctcctgagaccgacacaactgaaatagttgaaacaatcgtagagaagggtggt
aaacgacgagtcaagaaaactaaaaccgtcgtaaagggcgaagttcaagaatctgatgaa
atcattgaagaacagaaacctacaattgaggaagtcgaggatacaccagttgaagagatc
tcaactgaacaggaaagaaaaccatctgtaccatggcgcgaagaaacggtaacactgaag
aaaacaaaaacacagaagcaaccattaccaaaagaatcagttgaagaggtaactcttaaa
ccgtttaagaaaccagttgtagaagaaaccgcggttactgaagagtctccagagaccgac
acaactgaaatagttgaaacagtcgtcgagaaagttggtaaacgacgagtcaggaaaact
aaaaccgacgtgaagggtgaagttcaagaatctgatgaaatcattgaagaacagaaacct
acaattgaggaagtcgaggagacaccaaatgaagaacggaaacctacaattaaggagtta
gacgttacaccagttgaagaggtttcaatcgaacagcaaagaaaaccatctgtaccatgg
cgcgaagaaacggttacactgaagaaaacaaaaacacaaaaacaacaattaccaaaagaa
tcagttgaagaggtaactcttaaaccgtttaagaaaccagttgtagaagacactcctgtt
actgaagtgtctcctgagaccgacacaactgaaatagttgaaacaatcgtagagaagggt
ggtaaacgacgagtcaagaaaactaaaaccgtcgtaaagggcgaagttcaagaatctgat
gaaatcattgaagaacagaaacctacaattgaggaagtcaaggatacaccagttgaagag
atctcaactgaacaggaaagaaaaccatctgtaccatggcgcgaagaaacggtaacactg
aagaaaacaaaaacacagaagcaaccattaccaaaagaatcagttgaagaggtaactctt
aaaccgtttaagaaaccagttgtagaagaaaccgcggttactgaagagactccagagacc
gacgcaactgaaatagttgaaacagtcgtcgagaaagttggtaaacgacgagtcaggaaa
actaaaactgacgtaaagggcgaagttcaagaaaacgatgaaatcattgaagaaacgaaa
cctacaattgaggaagttgagaatacaccagttgaagagatcccaactgaagagtctcca
gagtccgacacaactgaaatagttgaaacagtcgtagagaaaggtggtcaacgacgagtc
aggaaaactaaaaccgacgtaaagggcgaagtccatgaatctgatgaaatcattgaagaa
cagaaacctacaattgaggaagtcgagcatacaccagttgaagagatcccaactgaacag
gaaagaaaaccatctgtaccatggcgcgaagaaacggtaacactgaagaaaacaaaaaca
caaaagcaaccattaccaaaagaatcagttgaagaggtaactcttaaaccgtttaagaaa
ccagttgtagaagaaactgcggttactgaagagtctccagagaccgacactactgaaata
gtcgaaacagtcgtcgagaaagttggtaaacgacgagtcaggaaaactaaaaccgacgtg
aagggtgaagttcaagaatctgatgaaatcattgaagaacagaaacctacaactaaggaa
gtcgaggatacaccagttgaagagatcccaactgaagagtctccagagaccgacacaact
gaaatagttgaaacagtcgtagagaaaggtggtcaacgacgagtcaggaaaactaaaacc
gacgtaaagggcgaagtccatgaatctgatgaaatcattgaagaacagaaacctacaatt
gaagaagtcgaggatacaccagttgaagagatcccaactgaacaggaaagaaaaccatct
gtaccatggcgcgaagaaacggtaacactgaagaaaacaaaaacacaaaagcaaccatta
ccaaaagaatcagttgaagaggtaactcttaaaccgtttaagaaaccagttgtagaagaa
actgcggttactgaagagtctccagagaccgacactactgaaatagtcgaaacagtcgtc
gagaaagttggtaaacgacgagtcaggaaaactaaaaccgacgtgaagggtgaagttcaa
gaatctgatgaaatcattgaagaacagaaacctacaactaaggaagtcgaggatacacca
gttgaagagatcccaactgaagagtctccagagaccgacacaactgaaatagtcgaaaca
gtcgtcgagaaagttggtaaacgacgagtcaggaaaactacaaccgtcctaaagggcgaa
gttcaagaaaacgatgaaatcattgaagaaacgaaacctgcaactaaggaagtcgaggat
acaccagttgaagagatcccaactgaacaggaaagaaaaccatctgtaccatggcgcgaa
gaaacggtaacactgaagaaaacaaaaacacaaaagcaaccattaccaaaagaatcagtt
gaagaggtaactcttaaaccgtttaagaaaccagttgtagaagaaactgcggttactgaa
gagtctccagagaccgacactactgaaatagtcgaaacagtcgtcgagaaagttggtaaa
cgacgagtcaggaaaactaaaaccgacgtgaagggtgaagttcaagaatctgatgaaatc
attgaagaacagaaacctacaactaaggaagtcgaggatacaccagttgaagagatccca
actgaagagtctccagagaccgacacaactgaaatagtcgaaacagtcgtcgagaaagtt
ggtaaacgacgagtcaggaaaactacaaccgtcctaaagggcgaagttcaagaaaacgat
gaaatcattgaagaaacgaaacctgcaactaaggaagtcgaggatacaccagttgaaggg
atcccaactgaacaggaaagaaaaccaagtgtaccatggcgcgaagaaacggtaacactg
aagaaaacaaaaacacaaaagcaaccattacctaaagaatcagttgaagaggtaactctt
aaaccgtttaagaaaccagttgtagaagaaactgcggttactgaagagtctccagagacc
gacactactgaaatagtcgaaacagtcgtcgagaaagttggtaaacgacgagtcaggaaa
actaaaaccgacgtgaagggtgaagttcaagaatctgatgaaatcattgaagaacagaaa
cctacaactaaggaagtcgaggatacaccagttgaagagatcccaactgaagagtctcca
gagaccgacacaactgaaatagtcgaaacagtcgtcgagaaagttggtaaacgacgagtc
aggaaaactaaaaccaacgtaaagggcgaagttcaagaaaacgatgaaatcattgaagaa
cagaaacctacaactaaggaagtcgaggatacaccagttgaagagatcccaactgaagag
tctccagagaccgacacaactgaaatagtcgaaacagtcgtcgagaaagttggtaaacga
cgagtcaggaaaactaaaaccgtcctaaagggcgaagttcaagaaaacgatgaaatcatt
gaagaaacgaaacctacaatagaggaagtcgaggatacaccggttgaagtgatcccaact
gaacaggaaagaaaaccatctgtaccatggcgcgaagaaacggtaacactgaagaaaaca
aaaacacagaagcaaccattaccaaaagaatcagttgaagaggtaactcttaaaccgttt
aagaaaccagttgtagaagaaaccgcggttactgaagagtctcctgagaccgacacaact
gaaatagttgaaacaatcgtagagaagggtggtaaacgacgagtcaggaaaactaaaact
gtcgtaaagggcgaagttcaagaatctgatgaaatcattgaagaacagaaacctacaatt
gaggaagtcgaggatacaccagttgaagagatctcaactgaacaggaaagaaaaccatct
gtaccatggcgcgaagaaacggtaacactgaagaaaacaaaaacacaaaagcaaccatta
ccaaaagaatcagttgaagaggtaactcttaaaccgtttaagaaaccagttgtagaagaa
accgcggttactgaagagtctcccgagaccgacacaactgaaatagttgaaacagtcgtc
gagaaagttggtaaacgacgagtcaggaaaactaaaaccgacgtgaagggtgaagttcaa
gaatctgatgaaatcattgaagaaacgaaacctacaattgaagaagtcgaggatacacca
gttgaagggatcccaactgaacaggaaagaaaaccaactgtaccatggcgcgaagaaacg
gtaacactgaagaaaacaaaaacacaaaaacaacaattaccaaaagaattagttgaagag
gtaactcttaaaccgtttaagaaaccagttgtagaagaaaccgcggttactgaagagtct
cctgagaccgacacaactgaaatagttgaaacaatcgtagagaagggtggtaaacgacga
gtcaggaaaactaaaactgtcgtaaagggcgaagttcaagaatctgatgaaatcattgaa
gaacagaaacctacaattgaggaagtcgaggatacaccagttgaagagatctcaactgaa
caggaaagaaaaccatctgtaccatggcgcgaagaaacggtaacactgaagaaaacaaaa
acacagaagcaaccattaccaaaagaatcagttgaagaggtaactcttaaaccgtttaag
aaaccagttgtagaagaaaccgcggttactgaagagtctcctgagaccgacacaactgaa
atagttgaaacaatcgtagagaagggtggtaaacgacgagtcaggaaaactaaaactgtc
gtaaagggcgaagttcaagaatctgatgaaatcattgaagaacagaaacctacaattgag
gaagtcgaggatacaccagttgaagagatctcaactgaacaggaaagaaaaccatctgta
ccatggcgcgaagaaacggtaacactgaagaaaacaaaaacacagaagcaaccattacca
aaagaatcagttgaagaggtaactcttaaaccgtttaagaaaccagttgtagaagaaacc
gcggttactgaagagtctccagagaccgacacaactgaaatagttgaaacagtcgtcgag
aaagttggtaaacgacgagtcaggaaaactaaaaccgacgtcaaaggtgaagttcaagaa
tctgatgaaatcattgaagaacagaaacctacaattgaggaagtcgaggagacacaatat
gaagaacggaaacctacaattaaggaggtagacgttacaccagttgaagaggtttcaatc
gaacagcaaagaaaaccatctgtaccatggcgcgaagaaacggttacactgaagaaaaca
aaaacacaaaaacaacaattaccaaaagaatcagttgaagaggtaactcttaaaccgttt
aagaaaccagttgtagaagacactcctgttactgaagagtctcctgagaccgacacaact
gaaatagttgaaacagtcgtagagaaaggtggtcaacgacgagtcaggaaaactaaaacc
gacatgaagggtgaagttcaagaatctgatgaaatcattgaagaacagaaacctacaact
aaggaagtcgaggatacaccagttgaagagatcccaactgaagagtctccagagaccgac
acaactgaaatagtcgaaacagtcgtcgagaaagttggtaaacgacgagtcaggaaaact
aaaaccgtcctaaagggcgaagttcaagaaaacgatgaaatcattgaagaaacgaaacct
acaatagaggaagtcgaggatacaccggttgaagtgatcccaactgaacaggaaagaaaa
ccatctgtaccatggcgcgaagaaacggtaacactgaagaaaacaaaaacacaaaagcaa
ccattaccaaaagaatcagttgaagaggtaactcttaaaccgtttaagaaaccagttgta
gaagaaactgcggttactgaagagtctccagagaccgacactactgaaatagtcgaaaca
gtcgtcgagaaagttggtaaacgacgagtcaggaaaactaaaaccgtcctaaagggcgaa
gttcaagaaaacgatgaaatcattgaagaaacgaaacctacaatagaggaagtcgaggat
acaccggttgaagtgatcccaactgaacaggaaagaaaaccatctgtaccatggcgcgaa
gaaacggtaacactgaagaaaacaaaaacacaaaagcaaccattaccaaaagaatcagtt
gaagaggtaactcttaaaccgtttaagaaaccagttgtagaagacacccctgttactgaa
gagtctccagagaccgacgctactgaaatagtggaaacagtcgttgacaaagttggtaaa
cgacgagtcaggaaaactaaaaccgacgtgaagggtgaagttcaagaatctgatgaaatc
attgaagaacagaaacctacaactaaggaagtcgaggatacaccagttgaagagatccca
actgaagagtctccagagaccgacacaactgaaatagtcgaaacagtcgtcgagaaagtt
ggtaaacgacgattcaggaaaactaaaactgtcctaaagggcgaagttcaagaaaacgat
gaaatcattgaagaaacgaaacctacaatagaggaagtcgaggatacaccggttgaagtg
atcccaactgaacaggaaagaaaaccatctgtaccatggcgcgaagaaacggtaacactg
aagaaaacaaaaacacaaaagcaaccattaccaaaagaatcagttgaagaggtaactctt
aaaccgtttaataaaccagttgtagaagaaactgcggttactgaagagtcaccagagacc
gacactactgaaatagtcgaaacagtcgtcgagaaagttggtaaacgacgagtcaggaaa
actaaaaccgacgtgaagggtgaagttcaagaatctgatgaaatcattgaagaacagaaa
cctacaactaaggaagtcgaggatacaccagttgaagagatcccaactgaagagtctcca
gagaccgacacaactgaaatagtcgaaacagtcgtcgagaaagttggtaaacgacgagtc
aggaaaactaaaaccgtcctaaagggcgaagttcaagaaaacgatgaaatcattgaagaa
acgaaacctacaatagaggaagtcgaggatacaccggttgaagtgatcccaactgaacag
gaaagaaaaccatctgtaccatggcgcgaagaaacggtaacactgaagaaaacaaaaaca
caaaagcaaccattaccaaaagaatcagttgaagaggtaactcttaaaccgtttaagaaa
ccagttgtagaagaaactgcggttactgaagagtctccagagaccgacactactgaaata
gtcgaaacagtcgtcgagaaagttggtaaacgacgagtcaggaaaactaaaaccgacgtg
aagggtgaagttcaagaatctgatgaaatcattgaagaacagaaacctacaattgaggaa
gtcgaggatacaccagttgaagagatcccaactgaacaggaaagaaaaccatctgtacca
tggcgcgaagaaacggtaacactgaagaaaacaaaaacacaaaagcaaccattaccaaaa
gaatcagttgaagaggtaactcttaaaccgtttaataaaccagttgtagaagaaactgcg
gttactgaagagtcaccagagaccgacactactgaaatagtcgaaacagtcgtcgagaaa
gttggtaaacgacgagtcaggaaaactaaaaccgacgtgaagggtgaagttcaagaatct
gatgaaatcattgaagaacagaaacctacaactaaggaagtcgaggatacaccagttgaa
gagatcccaactgaagagtctccagagaccgacacaactgaaatagtcgaaacagtcgtc
gagaaagttggtaaacgacgagtcaggaaaactaaaaccgtcctaaagggcgaagttcaa
gaaaacgatgaaatcattgaagaaacgaaacctacaatagaggaagtcgaggatacaccg
gttgaagtgatcccaactgaacaggaaagaaaaccatctgtaccatggcgcgaagaaacg
gtaacactgaagaaaacaaaaacacaaaagcaaccattaccaaaagaatcagttgaagag
gtaactcttaaaccgtttaagaaaccagttgtagaagaaactgcggttactgaagagtct
ccagagaccgacactactgaaatagtcgaaacagtcgtcgagaaagttggtaaacgacga
gtcaggaaaactaaaaccgacgtgaagggtgaagttcaagaatctgatgaaatcattgaa
gaacagaaacctacaattgaggaagtcgaggatacaccagttgaagagatcccaactgaa
caggaaagaaaaccatctgtaccatggcgcgaagaaacggtaacactgaagaaaacaaaa
acacaaaagcaaccattaccaaaagaatcagttgaagaggtaactcttaaaccattaaaa
aagcctgtggcagaggatattccagttattcaagaagtggcagatattcagaaaataggt
agtgggattaatgttgttaataatgttgtggaggtagatactgtgtttaaggaagctgat
gttcctgctgttgacgatcaacctattattaaaatccggtttttaaagcatgatgatttg
ttaaaggaagatgttgctaaaaagcctaatgcaattgtttgtgctcaaaaagtcatatca
gttcctaaagaaaaaaacaagaagaataaaaaacatgttcaattgaatgaggatatgaat
caagaaaaagaattttctcctgacgatgaagttagtgccctgaacgatgaggaggttgaa
gtaccttctccgaaaatactagactcaaaggatctcaaaggaattatgaaaccgagggat
gagattgtgtctgttcctgatgttgttcttaaagatgaagaggaatctatagatacttta
gcaaagcctaaaaatttaactgaacagaaagttccaatcaaacttctgggtgaaaagttg
gaacttccatggagaaaaggacgtaaagatatcgataatgacgttactgatattgatatt
attgataacactgaaagtcatgttcctaaaaaagaattgatgaatgttgttgagttaatt
tcacaacagccaaaatcattggaagttaataaaccgttatttggtacagttcaacttaaa
aagtcttcaaccaaaaaaattaacgaaattgaaccattggctgttcctaaagttctacta
aaatctcatatttatagaatcgatttaaatactaatgagcatttcccttctacttcatta
ttagaacctatttatgtagacaacggagttctgtccagaaattacgccgaggctatgaaa
ataaagaaaaccaaacctaaggtattatcacttcccgatctagaacctgttgttcttgag
aagtttgaaccaaccgattttcattatgataaaaaggaaacacctgagagaaaaccttct
ttaacaaaacaatcagttgataaaaaaattccagacgaagaaaccccgaaaaagttaata
attggaaaaggaaaaatacctattcaggatgacgatcaagaaaaagttatattaaaaaaa
gttccccaaaaaccagtggaagaaaaactggaaatgccaaagccaattaaaaaaccacat
tttaaacctgaaccagattcaaaaccatccgaagacatagattttacactagaaccattt
aaacctataactgtgggcacaagtcctgaagtgtctgagccaataccgtttggtaatgaa
agtttccctgacgtagaattaccagttaaaaaacctaaatatatccgaaaaaaaataaag
aaagaagaagagcctattcctgataacaaaatattacctggaacaccgaggcctgtacca
ttggatgaagaaaaagatattaatctcaagtataaacaggggaaaccagaaccagaatta
cctgacgaaataaaattaaaaccatttttattagaaaaaccaattgacgttaaagaaccg
gatgacctcaatttaggtaaacctgatgtatttgattatcctagagaagaagaacaactg
aaacctcgagattataagtttaaaccagagaaaaaaaagaaaaggccttcgaaaactgtt
gatattgataaaccaattgatgacaataatgacagtgaaatcgagccattgccaatttct
aaagaaagtcctgtacttgaagaaatggttaccattgatgtaaagccaactaaagttgta
gctgttgcgttagacaataaaccattgttagcaactatcaaactcaagaaagctcctact
aagtcgaaggtcgatgttgaccatgtacaaatccccaaagtactattgaagtctcatata
aataatattgaatttaatacacatgaacattttcctactacttcattattagaacctatt
tatgtagacaacggagttctgtctagaaattacgctgaggctatgaaaataaagaaaact
aaacctaagaaattaatacttcctgaactagaacctgtagttctagagaagtttgaacca
actgattttcattatgacaaaaaggaagcacctgagagaaaaccatctttgacaaaacag
tcagttgataaaaaaattccagacgaagaaaccccgaaaaagttaataattggaaaagga
aaaatacctattcagaatgatgatcaagaaaaagttgtattaaaaaaagttccccaaaaa
ccagtggaagaaaaactggaaatgccaaagccaattaaaaaaccacattttaaacctgaa
ccagattcaaaaccatccgaagacatagattttacactagaaccattcaaacctataaca
gtgggcataagtcctgaagtatctgagccaattccgtttggtaatgaaagtttccctgac
gtagaatcaccagttaaaaaacctaaatatatcagaaaaaaaataaagaaagaagaagaa
cctattcctgataacaaaatattacctggaacaccgaggcctgtaccaatggatgaagaa
aaagatattaatctcaagtataaacaagggataccggaaccagaaatacctgaagaaatt
aaattgaaacctattcccataaaaaaacctttagacaataaggagactgatgatgatgaa
ttaggaaagcctaagccttttcctagtgattttcctaaaattgacatacattctaagtcc
aaaaaatcaccttcaccgaaatccataagcgttgatagccctttgcaggatttagaaata
gtgagtataaaaagaagtgaagagaaacctgaaaataaatcaattgagagtgaaattgta
gcaccctattttattgaaaaagtgcaaccattagtagcggaacacgaaaagcctactgct
tttacgtgctctgtggggggaatccctacacctgaagttaaatggtaccgagacgatcgt
gaactacaaacaactgatgtttatgaaataattgtatacgagaatacatctactttgagg
atttctaaacctacagaggaacaggcgggcgtttatgtttgccaagctacaaactcagct
ggaatttcaacttgtactgcacttctggtggtgttagattctgaagaaattggcgaagct
ccaacttttgtggaaccgattaaacctaggaaagtcaaggggaaaaagtccatagaattg
agatgtattgtgaaaggaattcctatacctgaaattatttggtgtcgtgaaaatgaagaa
ataatttcggacgatgacgaatatagaacttcatttgattctaaaactggtgaagctata
ttaacattagtaaatcctattgaagtagaccgatctacgtatctagctagagcggtgaat
attcacgggaaatctgaatgcatggcacatattacatttgaaaaagaagaatatggagaa
gcgcccaagtttgtggaacggttgaaaccgaaagttgtgaaagctaatgaaacaactgaa
ctcacatgcttagtcaaaggtgttccatcgccatcagttgtatggtgccgtgatgatgaa
gaaatcataccagatgaaagtcatatgctaatttacattcctgaaacaggagtgtccaaa
cttattatagtgcaccctgatgatattgatgagtcaacgtatacagtgaacgcaattaat
aaatttggaagagctgagtgtagagcaaatttaatagttcaaaaagatgaacttggagag
gcaccgacatttgtacaaccagtaaaaccgaaaattgccaaagcaaatgaaataactgaa
cttaaatgtttcgtaaaaggaacaccgaaaccgttagtaatttggtgccgtggcaacgat
gaaataattcccgatgaatgtcacttggtcacataccaccaggaaaccggagaatcgatc
ttaacgattttgaacccgacagaaatcgatgaaactatttataccgtgaatgccgtgaat
aaatacggccaagcacaatgccgggcaaatctaattatacaaaaagatgaatcgggtgaa
gcaccaatattcgtagaaccgataaaaccaaaaatcgctaaagctaaccaggccaccgag
ttaaattgtttggttagaggaatacctacacctactgtcgtttggtttagaggcgatgta
gaaataattccagacaccactcattcaataacgtttataccagatacgggtgaatcgaaa
ctggttatttcaaaagccacagaagttgatcagaacacatacactgtaaaggcaaccaat
aaatatggcagagctcaatgccgggcaaatgtaattttacaagaagatgtttttggtgta
gccccgagctttgttgagcctataaagcctgtactagcaaaaccagaccaaacaactgtt
ttacggtgtttggtgactggtaatccgatgccaactgttgtttggtgtcgtggaaaggac
gaaattgtttcggatgaaatgcacacaatccagtttatttcagaaactggagaatccaca
ttaacaattgaaaaaccaacaacagtcgatgaagcgcgttattcggtagaagcaataaac
aaatttggaagagctatttgcagagctaatttggttttagaaaaatatgacactggaatt
gctccagaatttgtcatcccgatcaaacccaaagccgtcaagccaaccgaaactgtagaa
ctacgttgcgtggttactgggacaccaatgccaaccatcgtatggtgtcgtggtgacgaa
caaattgtgccagacgacagtcatgtcgtatcttatacaccggagactggcgagtccaaa
ctcacgatctgtaatgccacaggattggacgtaaacgattacaccgtgaaagcagtcaac
gatttcggagtggcacagtgcagagccaatctgattatagacgacgtcgttcaagaaata
cctataccgttagaggaggcgccatctataactaaacctttggaaccagtaatagccaaa
aaagattcgtgcgtgacgttagacgtgcatttcagaggaactcccgagttaaaagtacgt
tggttccacaacggcaaagatataaccgataagaaaacgttcatgcgcactttaactata
acggagaccacgactgtgataattattaagaagatcaccaagaaaactactggacgttat
gaagttgtggtcactaataatcgcggagaagcgaaaacgtccactacagtattgattgaa
gacgaagatgatgtagaggagagtatagtaccagaagaggcggttgtcgggaaagcgccg
tatttcgaaacggaattgcaaaccgaaacaatatgggaggaggaggaggaagaagaagaa
accataatacgcctcgtcgtaagagtaaagggcactccgaagcccaagatccattggtac
gaaaacggaatggaaataacgcccagtgaagaatttgaaattgaagaacaggacgaagga
gtatctgtgttgatggtcaagaaaaggccaacggagagcgttagggaaattacgtgtgag
gccacgaacgagtacgggacggccacaactaggactttaataatcccaggtattaaaggg
acgaaagcctacagaaagccgtcgtgggtgacccagatggaagagttgcgggaacaatta
caagctttccagagtctaccaagctttgtaaacgaattaaaagacgagcgagccgttgaa
aacgaaacgattgtgttcgaatgtcaattttcaggaaatcctactcccgtgattatatgg
tatcacgatgataaaattgtcagaaactcacctaatgttcaagttaaaatcactgacaca
aaaactacattaactattaagagagtaacaaaggaagatgaaggtgtctatatttgcaaa
gcgaacagcaatttaggagaagctaaaaataaatcaaaactttatgttaaaaaacacggg
gacgaaacattcacagctaccgaagatgaattagaagaaaaagaagtggaagaagtaaag
aagacgaaaaagactaaaaagaaggctacaaaaaagaaacataaaaaagaatctgaatta
tttgatgaaacggaaacaaaagaatcacttcgtattactacttcaaaaatggtggaggaa
aaaccatctttaccggaacacgaaccgttgtctacgtcagaaacggtttcggatgagact
gtcaaggaagttcgcggacccgaacatgttcgcccaaaaacgtccgaagaaccagcgctg
tttacagcactcaaggtccggaagcccgcggtagtccatgaagttgaccaagtgttggat
caagttgaactggctgagtttggaccggctgaatggccattacgggaattggccaccatc
gatatactcacccgacacggcatatcaacggaacaggtgttcgaagaatacacgtcgggt
cagttccctgcattgaggaccgcgcccgctcagtcagcaatggtgcatctcatcgaacgt
gaaggatacacatctttggtggctgacgtattcactaaagaatcgaccatacctgaaacc
gtcaacgaagtgtttaaggcatttatgacaatgattgagttgaaacatagcacactggaa
gagatcattacttacttgacgccagaagacttccaaaccagcacctgggatttcgagcac
gcatctcaaatgactacagacgatacgatcaccgatacagctgatatcagcgagtctgta
aacatattagtgaatgaagttaaaaagaaaacgcgatctacaaagaaattagtaaaaacg
agcgaagagactttgtcaatcgacaatgaacaagtacagaacatactggatgatagaagt
gttaaaattactgaaatcatggataatagtaatgtgacaattgaagtaccagaagataga
ctaatcaaaacggaaaaaataatacaacaaaaaaagaagatggatgatataactgtcagc
gaagatgaggaaaaagaagaaattatcacagctaaaacaaaaacagtaaaaagaattaaa
gtaaaacgatcaatcactggtgaagaaattattcctgaagaaactacatacgaatttgat
gtagaaaagtatcctgctatttgtccaactgttctgaaaacatcaaaaactttaaacgaa
acaatcgctcagcaagaagctgtagagttgtcaactgattataataatgtaccggaaaaa
gcacagattagaataataacacgaaatgtcgcggaaagcataataacaaaagacgaagaa
aaggaagaaaaccgaaaagaaaccttagaaactaaaaaacataaagcaaattctgttttt
gaatttaatgaaagtttttcaacagataaccctgaaactcaatcgcctcttgaagacatt
tgtaaaacgtttgagtttataccatgtttagcgataaaagatattatacccaaagaaagt
ataaatattattgaaatttatcctaatcaaagcttaggtaaaggaactgagtacaataca
caaaatgagaaagctaaggtaactgtaatttcacattcacaaaaagtagtcacagaattg
attgcctctacaaaagaaggtgaaattatacaaaaatgtatgccacagaaaaaaaaagct
acacaagattatgttgaacacgagagtattaatgttgtggaagtgaatgaagcacacact
gaaaatcaattacaagacgtatttaaaccaacaccagtgaaatcttcagttaaatatcca
cttaacgaacaattagttgtcagtgaattacattcagaaattcaaccagaaaattactat
ccagaaataattgtgcccactgaaatcgccaaagaattaatagtaccatcaaacaatgct
ataacgacatgccaagtagaattttcggaaaaagaagaaaagtataatcgattaaaacca
cctattgaatataaagcagatatttcaattattcctgaaaaatatatcgaagtcagtgag
tctaacatacaagaaaaagaaactaaattagaaaaacaacaaataccagagaagtcattc
gcaatttctgatataattgtacagtcaagcataattgtaaattcaattaatcaagaagaa
aatgaagaaaaattcaatactcatatacctcaatcccatactgcaaaactgtcaataaac
aacgcaaataaagtttgtagttcgtcaataatagaaactaatgaagcagaatctgattta
aaaattctgatcgtaccagaaatgaaacaaattgaaagctccgtttttggtttagaagtg
ctggatgtaactgagattatacctaacgagacagaatccaattttacatcagaatcagta
ttagaattattaccagatactagttttaccgaaaataattcatgcattgtcactgaaact
acagctgatgattattcaacagatttattaacaaatttgaattacaaatcgtatgaggtc
gaaccaacatttgaagaattagaagccaaacaaatatctcagattgatgtacaagaaaat
gacattccattagatgaaacacctcaaccaatgtcagttaaaccagaaacaaagttttcc
ccaattcaaagtataactgtagaacaaacaattttgggagaacaagagcagttattgtta
ttgaaaatacaaccagagttgcataatactgtaagtgtgccatctcattctctccaagct
gtagttattgaagaaattacaccggaaaattgtgtcacaaacctagaaagcacgtataaa
gacaataatcgacacgcttctaaaaaagcacacattaactttgtagatgaccaatgtatt
attgtaaaggaaatttctgcttatgagtcggaatctaatttatcactggatagtaaacct
gaaaatgtacgggcagtaccagtgttttccggtcacgatgtggctgaaacaatagaaata
atttcaaatgatgcagttgaaaaattaaatatagaaaaatgtaaaaacaataaggcaata
ctaaaacacataccgtatgaagcatttatgtcagaagtcacatctgtaattgagttagaa
gatattttactaaataaagaaaagaaacaaccaaaaattgtaaacattacaattgacgaa
gtaattggggtaaatattacagaacagcctgtttacgaaaaagaaaaaatgtcgtctgaa
caaaaagtttttaaagctaaaaatgctattactgaatatgttccaattgagacatttgat
cgctcggaaattgttactggagattatactttagatttgatacaaccggaaatttctaaa
ttacacgcatatcatcaacctagtacatttgaaagtgtaattttgtacgaaaccaacata
tctgaaaaagaaaaagtgatgatagacgacaaaaaaccattaccatgttcagcaaataca
tcgttaatagtagatgaagcaatagaggttacagaaattatttctgacaacaaaccagaa
gacattattatttcaatagtgcctaaagaagaaacagctgaaactaatattataccattt
aaacctctcgcaggtcaagacatcacaacttgtgaaaatgtggagacagtaacagataat
agtccaaaaacaagagttgcgcatatatcccaaaaagcgtttcatggtctacaaacgact
ttaataatatcaacagattcagaaaataagctatcggaatttgtgatgccgaattcaaaa
aaagcagaaactaattatactgaattggatattccaattagtgtagttgaaattttaacg
caagataaagagttagattttaaagctaacgaaataccatcacatacattggacagacaa
gaaattatcttagaagaatgtcgggtaacgtcagaaacaatggtatgcagttctactagt
gattttgatgaatttataccacaatcagtttatgctttgtcttctaaaagcactcaaatt
gcaattgaatcaatagaaaccgctcctcttgaaaaagaaggtgatttaatggatgataat
atactttcagagaagcgtgctgatttagcgtatgaagaagtaaagagcattcaaatcact
gaacaagttcaactcgacaccaagcaaaacttaataattgaaagtatacctatggagaga
aaaagtaatattacaatcacaggacaagatgctgcagaaacatttcaaacaaaggtagaa
agtcccgttgaagaattaaaaatagaatttccaaaagaaaaatctgctaaaactattcaa
gcaaaagaagttcatggcgttgaaatatctgaaataataacacaagagacagaatcttca
ttagatgatactaaaccatacaacaaaaaaacagtgaatattttagttgaagataattca
gcaagttatatggttactgaaatatttcctaatgaaaaagaaattcaattgatagaacaa
tctcagccaatttatcgccatgctgaacaagatattttaagccacgaaggactgcaagtg
aacgaaacaaatatttcaatttgtgaaaaggagttaagtgattttgaatattcaataaaa
ttaggtaatcaagtaatagaacccctcaaatgtattgaaatatccgaagtaaatgttcaa
gagccagaatataatttattcaaatcagttcatccaaaaattgaaaatgccattcatagt
ttagaagaaaatgtaggacttataataaattctatagaacttattgataaagaaaatgag
cttaaaatagataaattgaatactaagaatgcaactaaagtttcaaatttaattgactat
agagttcctcagaaatctgaaaaaacaacattggagtgcgttaaacctttaaaagatata
aaagaaacagtacaacaagcatcatctgaacacatattattagaaggtataagtacaact
gtagtcaatttacaagataatgaaatgccatttgagcaatcaactaaattaaatgaaaaa
tctgcctctctagaatatgaaatggaacaaaccttaaatgtaacagatgtatgtataggg
gaatcagagtcagatttaatccctacgtctttaccaagaagccacattgcagtaagtgat
atgtcagaaacccaacaagttgcatccagttttgaaattctctctcagaattccacacat
aatttaagtgttcaaacattgccatctataatttctataattccaaaatctacagagaat
catagctttgaagttaccgaaacattgtatcatgaaactgaaataccattcaaatctacc
gaaaatgcattaaagacatgctgtcttacaattcaagtggataaaaatattgtggtaaca
gaaattgtaacgaacgaatcagagaaaactttagatttagttgaacttaataaaggctca
gaagcaaatatagtatttgatgaaaaccagactgttacaatcgaagaaatagaaacgtct
gacgatgttgctccgttaactgaaagtttgagtaaaccattgagtgcaacgaaacaatta
gaaccactattaggaattttggttaccgaagttaggtccgaagaatctgaaattgcgaat
gaaaaacaaatccaaccactattaaaacatgtaacgcaaatattgccagaaaatcaaagt
ttgaatgttacatccacaaatttagttgaaaaagaaagtatactaaataaacctaagcaa
gaaattcaacaaaatgcacaaacttctttggtattcagtccaatgaaagccgttcaatta
aaagaaaatattatacaaatgagtttgaacaatctaaaaactacaacgcccagtgaaata
tttatagaatcaactcaaattccttatgattcaattaatcaattagaaattagaccattc
gaaaaagaatgtgaattcaaagtgacaataaatcagaaaaaagaagtagcaaacattaat
gtggataccataaatatactcgacacaacagaaattataacaggtgaaaaagaaactgtt
tatactcctttaacaaaaccaataacaagacaagcttttatcgatataactgacactcaa
ccagtcagtaaggtttttgaagtaaaaccagaagatagtacaagtgaattaataactcca
aacgttaccacatgtacagtgaaaccagctcaggaaattgtccatggtgttgtgattttc
gacaatataggtcatgataaagaggagatatttgaaggggaatttagaccaccccttaca
actgctaaaatagttgtagaaaatgaaaaagagacgaaaactgtaactgaagttataact
caagaaatggaaggacaagtaaaaaatgtagaattgccatctactaaacatgcccaaata
gaaataacctcagggaaagacatagcagagaaaacagaaattttatcaaatactgcttta
ggatcattaaaagattttgttaccaaatcatcaactgctgttccagtacaagatacattt
gaaagtattcaatctactataactgaaacagaggacaaagaaaatccattctattctaat
ttaaactaccaaaaatctaaagtggatataaatattgaacaatcaaaaagcgtaaatata
actgaagtgattgtggaagataaagaaggaaaatatatttctccagaaataccaacagcg
aaaactgctgggaaatcaattttaccaaatgaagctgcgaaagcatctattgtattagct
aatgaacatttaagaacattagataagtttaaaataaaagaagaattggctaatattgta
ctcgatacatttaaaaatatatctcaaactgaaacaactgtacaggaaagtgaaaaatat
cttgaacctattgaactactttcaaataaagctgaacttacaatgatacctaacaatagc
ttaattataactgaagtagtaacagatgataaagatgacaatttacatatcaaaaatgaa
cagataccacaacaagttattacatctttatcaaaattacacgaagtaccacaagtatca
gaaatcatttcatcaaatacaactagtgatgtatttgttcctgtaattaaaaatgatcac
gcatttatttcacattcagagctatacaacatggcgatatcaactgagataaaaacgtta
gaaaaagaaaaattgtttgcacaaaagcccaaattggacatttttaaagcagaaattaaa
ttaaatgaagataaatcactaaacgtctttgaaactgtcttaaatgataaagaactgcca
ttaacaataaaaaaaccttttgaaaaacaggcatcattaactcagtcattatttgacgtc
gtaacaatatcagaacatattgtgaatgaatctgaaatgaatctcgaatcaatgatagta
ccagaagtacaaaaggtcgatatatcatttgaagataatattaatgttcaggtaactgaa
gcaaatattgtcgacacagaaattgatttgttaacacctattcaaaatactgaaattgct
acggttcctaaattaataacacaaccagttgcaaatgttacggaaattataacaagcatg
aatgttcaagaactaactcaattgagtcaacctgaatatagcatagcaagtgcaaaccat
tcaacatttaaaagcattttacaaacagagattgatatagcagaatcagaaggtatctta
gaaaaaccaagatgtatcaaagaaaaagcatcagtgaaaaccgaaacattagaaaacata
ataataacagaaccagaagtatctgaaaaagaggaaccacttgaagaatcaaggaaaata
gatttgagacatgcagaacttgtattagaagaaattaagtctagtatcattatttcaaat
gtagccagtgaagataaagaaactgcatttgccgaaggaccgaaacgcaaacattcggta
gcaaaagttgtttcggaaaacttacaagtaatcacgaatagtgaacaaaatgtttctgaa
aaggagggtactttaattatagaacttccaaaagatgaaactgcaaatatatcatttgaa
aattctcagtccggaattatagtttcagatataatccccgaaattaaagaagaaaattta
aaaataaaaaacacatcatattcaaccgcgaagtttgtgacggaaaattatgaaagccta
atacaaaatgaacaaacagtgaatgaaaaagaacaattaagaagatctgaacaaaaacca
gaaataactaatgcatcaatctccattgaaaaaccaaatataggagcggtagtttccgaa
gtgataagtcatgataaagaaattgattttcataaaccacaagtaagaaaaatgtcaaaa
gcttcaatatcaacagaagaattaaaacctctagtaactacggagacacaacttttatcg
aacattgaagaactaaaagtacaaaaaatacttcccgataatacagctaacgtaaaatta
gaagaatttagacacctaaccgtacatgaactagtcactaatgaaacggaatcaaaaata
aaagaaataaatcaaatccaatgcaatataatgccaacagtcaacgagaaaatgatctta
gaatctactgtaaatctaaaacaagaagcaatagaccatcacagagcatcaatcactgaa
ataccaatgagcacaggtgaatttgttaacaacattttaaaagaagaattgtctgatgaa
ttgattgagtctccgttagattctcatacatcaaaaccaatgggcgagcctacaattatt
gataaaattgatactactccttttaaagaagttgatattaaagaagctttttcgacctta
aaaccaagaaagaaaaagtcaatttctgatgaagatgaaatagttagtgtcacgtttatt
ccaaaacaaacgaaacccaatgagataattgaacaagaatttagtatcaaagctcaaaca
tatgaagaagaagaaatttccatgaccggcaatgtaaaactgcatcgaaagtcagtttta
gacgaacctataaaatcattaactataaatgaaatcaatgaaatcgaatttcaaccagac
gatcttattaagaaactaaatgaacaaagttcacatgatgaagatgttcagccttatagt
cctattgaaaatattataaaacccgtagaacagacttttgataaagtcataactgatcag
gctgccactgaaacaccaaaaagaatttcaaatcagcttgaaactgataatgtcgagcat
gaaccaagtagtaaaccttcaataatgaaagatgaagcagtagatggtataactattgaa
caaattgaaactattgtaaaagaagaagaccagcccacagaagacgttgaagtcgagtta
aaaccaaaaagaaagacttctcttaaaaaggaaacaaaagaaaaatctctggaacaatct
tctgtccttctaaaacgaccaaagaagaaagaggaaataccacggactctagaagaacaa
gaagaagtgttcacgtttaagaaaacaattgaaaagccagaagatgttcaaccaatatct
gaaacagttgatgtagaaattgaaccgaaaagaaaaccatcagtaaagaatgaagaagca
gcagacgagataactattgaacaaattgaaactattgtaaaagaaaaagaccggcccaca
gaagacgttgaagtcgagttaaaaccaaaacgaaagacttctctgaaaaaggaaacaaaa
gaaaaatctccggaacaatcttctgtacttctaaaacgaccaaagaagaaagaggaaata
ccacagcctctagaagaacaagaagaagtgttcatgtttaagaaaacaattgaaaagcca
gaagatgttcaaccgatatctgaaacggttgatgtaaaaattaaaccgaaaagaaaacca
tcagtaaagaaagaagaagcagcagacgagataactattgaacaaattgaaactattgta
aaagaagaagaacaacccacagaagacgttgaagtcgagttaaaaccaaaacgaaagact
tctcttaaaaaggaaacaaaagaaaaatctccggaacaatcttccgtacttctaaaacga
ccaaagaagaaagaggaaataccacagcctctagaagaacaagaagaagtgttcacgttt
aagaaaacaattgaaaagccagaagatgttcaaccgatatctgaaacgattgatgtaaaa
attaaacctaaaagaaaaccatcagtaaagaaagaagaagcagctgacgagataactatt
gaacaaattgaaactattgtaaaagaaaaagaccagcccacagaagacgttgaagtcgag
ttaaaaccaaaacgaaagacttctctcaaaaaggaaacaaaagaaaaatctccggaacaa
tcttctgtacttctaaaacgaccaaagaagaaagacgaaataccacagcctctagaagta
caagaagaagtgttcacgtttaagaaaacaatcgaaaagccagaagatgttcaaccgata
tctgaaactgttgatgtaaaaattgaaccgaaaagaaaaccatcaataaagaatgaagaa
gcagcagacgagataactattgaacaaattgaaactattgtaaaagaaaaagaccagccc
acagaagacgttgaagtcgagttaaaaccgaaacgaaagacttctcttaaaaaggaaaca
aaagaaaaatctccggaacaatcttccgtacttctaaaacgaccaaagaagaaagaggaa
ataccacagactctagaagaacaagaagaagtgttcacgtttaagaaaacaattgaaaag
ccagaagatgttcaaccgatatctgaaacggttgatgtaaaaattaaaccgaaaagaaaa
ccatcagtaaagaaagaagaagcagcagacgagataactattgaacaaattgaaactatt
gtaaaagaagaagaacaacccacagaagacgttgaagtcgagttaaaaccaaaacgaaag
acttctctcaaaaaggaaacaaaagaaaaatctccggaacaatcttctgtccttttaaaa
cgaccaaataagaaagaggaaataccacagactctagaagaacaagaagaagtgttcacg
tttaagaaaacaatcgaaaagccagaagatgttcaaccgatatctgaaacggttgatgta
aaaattaaaccgaaaagaaaaccatcagtaaagaaagaagaagcagcagacgagataact
attgaacaaattgaaactattgtaaaagaaaaagaccagcccacagaagacgatgaagtc
gagttaaaaccaaaacgaaagacttctcttaaaaaggaaacaaaagaaaaatctccggaa
caatcttctgtacttctaaaacgaccaaagaagaaagagaaaataccacagcctctagaa
gaacaagaagaagtgttcacgtttaagaaaacaatcgaaaagccagaagatgttcaaccg
atatctgaaacagttgatgtaaaaattaaaccgaaaagaaaaccttcagtaaagaaagaa
gaagcagctgacgagataactattgaacaaattgaaactattgtaaaagaagaagaacaa
cccacagaagacgttgaagtcgagttaaaaccaaaacgaaagacttctctcaaaaaggaa
acaaaagaaaaatctccggaacaatcttctgtccttctaaaacgaccaaagaagaaagag
aaaataccacagcctctagaagaacaagaagaagtgttcacgtttaagaaaacaatcgaa
aagccagaagatgttcaaccgatatctgaaacagttgatgtaaaaattaaaccgaaaaga
aaaccttcagtaaagaaagaagaagcagctgacgagataactattgaacaaattgaaact
attgtaaaagaagaagaacaacccacagaagacgttgaagtcgagttaaaaccaaaacga
aagacttctctcaaaaaggaaacaaaagaaaaatctccggagcaatcttctgtacttctt
aaacgtccagtcaaaaaagtagataaatcaaatgaaatagatcaacacgaagaagttttc
acaattaaaaaaacacctgagcaatcaatgttattgaacgaagaattctctgaaactgta
gagtttaaaatgaaaccaaaacgtaattcatcagtttataatatagatgaaggaactgag
gaattatttcaaatagaattaaaacccaaaaaggaattgcaggatataaaaatttacgaa
gaagagtcgttagattttaaggttaaacgaaagccttcattacattcttttagtcaagat
ggagctgagttgaaaataattcaagaaaaagaaatttttgtgaaggataactccacttta
caagaagatagtcatgatggtgagataatgtttgcaattcggtcatacattgctgaaaat
gaagatgctttagacctagttgaaggtgaaaaagtttacgttatagaaagcaataaccaa
gattggtggtttgttaaaaaacatttaacggaagaaaaaggatgggttccttctatttat
ttgagagatgaaaccagctatatgcggtacgtacaaaagaaattacatgaaaagattgat
aaactgccaattttccaaagacatgcttcaacagaaaaaccttcagctccacgttttgtc
gaaaaactccaacctaaacatgtgcaagatggtggcactgttcagtttgaatgtcatgtg
gaaggaaatcctaagcctcaaatcacatggtttaggcaaacagcaataattaaaccctct
caagatttccaaatattctatgatgaagacaatgtagcaacgttaattatcagagaagtt
tttcctgaagatgctggcacatttacgtgtgttgcaaaaaacgtagctgggtttgcatct
agtactacggagttaaccgttgaagctccattatcagaccatggttctgatgtaacaggt
ctctccagaaagagcatgtctagagaatcgtcattagctgatatactagaaggtatacca
ccaacgttttcacgtaaacccaaagctacgtgtgcatcagaacactcagatgttacaatt
gaatgtcgtcttgtagccgtaccagaaccagatatattctggcattacaatggtaaagaa
atttcgatcacagattccataaaagtgaatacatactcagacatgcacttctatgtgagc
tgcattaaaattaatgacgtcctaaagactcaagaaggcgtatactctgtaatagcaaga
aatagagagggtgaggctaaaatggatttggttctcaaagttaaaacgggattaccagag
aaaccacaaatacttgaacctttatacgacataactataaacgagggagagactgccgtt
ttgagtactcaaattagtggagagccccagcctatggtcgaatggctaaaaaacagtaag
aaaataactgatattaaaactgtcgtgaccaaagatggtgtccattcattaaccatcgat
aacccaactccacgtgattccgcaaaatacactgtaattgcttcaaacaagcttggtaat
gcacaaaccatgtgttttctggcagttgaagaactccctggtccacaagcgccgctgttt
attgaacgtttccaagaacaaaccgtcaaagaaaagggaactattacattaattgctaag
gtaaccggaaatccagttccaatagtttcttggttcagaaataataaaccattacttgct
tcgtcaaagaaaaaagaagtatttgatggtgaaaatatagttttggaaatcgtaaatgct
gacagtgaagaagacgctggtgattacaaatgtgtagcatcaaacacatttggtactgcc
acacatggtgctagggtgtcggttgatgtaccactagtgaaattcacccgaccattgaca
gacgtggaagtcgatgaaaaacaatcaatttatttagaatgtgaaacatcacacacagtt
tccacaaaatggcaattgaatggcaaagacctcactggtatggaccacagagaattgcac
caagaaggacgattccatcgtttaattatcaaaaaatcaagcattctcgattctggaaaa
tacacttgtctagttaaagaccagattacttccagcacagtagtagttcacgatgtaaaa
gcagagtttgttaagaaacttgaagatgttgaagtaaaagagaacgattgtgctattatg
gaggttgaagtttcttcagaaacagtaaatgttacttggcacaagaacggtgaaatgctt
acggacggtatgaacaataaagtattcttcgaaaaggaaggtcaaatacgtaagctaatt
attcgaagcatatctgttcatgatgacggtgaatatacgtgttcattgggtgaacaagaa
tgtacagcagaaataaatgttatagaacttgcaccacaaataataaagaaactaaaagat
caaaaagttgctaccggtgaacaagtgttatttgaaatagaattaactaaaggtgatgca
ttagttaaatggaccaaagatggcaaagaattacagttaaataacaatgtgagattaact
atcgatggcaaacgacaaaaattagagatagtcaaagctacaaaaactgacactggagtt
tatggatgtcaagttcatgagcagacttgtacagcaaaattaacggttgaagaaccaaga
gccagttttgtgaaaaaattacctgatatcacactcgccgttcaaggtagtgatattaaa
cttacggttgagctttccaagccggatgtaccagtaaaatggctaagatcaggtaaagta
ataaaagaatctgataaatacgaaataatttctgaaggagccgtccataccttaattatt
aaaaaacctactaccgatgacgaagcagaatatatatgtactgctgttaacgtaaaaaca
tcaacgaaattaaaagttgaagttaaagaagaggcacccaagataaataatcttccaaaa
gaatatcgtttgaaaaatggggaagatctaaacgtggatgtaacatttacatcaacaccg
ttgccgacagttgaatggtttattaacggaagtgtactaataaaaacaaatagagtttcc
tattctattagtgaatcatcggcgagtttgaccatctcgaagatagaagaagtagacacg
ggtgtcctaacattaaaattaaaaaatacttttggtgaaactactgcggatatgaacatt
attgttattaaggtacctggagaaccaggtgttccagatgttattgaagtcacagacact
tcagtcacacttcactggaaacctccacaatttgatgggaattcacctattgaaggttac
gttgttgaataccacgacaaagatgaatttatggtgtggcataaagtacaagtgacagat
accacacacgaagtcacaagtttagtaactggacatgaaataatgttcaaagtggcggcg
ataaattgtgctggaataggtccttcatcacacaatacaaaatatatcaagatggcaagt
ccaggatcatttactccacccgttattcaggaacctttatctgatttatcaattggaatg
ggtaaatcggcagtgctccaatgtgtaattactgggaaacccacgccggatataaaatgg
cttaagaacaaaacattatataaaacaaagtcagcgtcctttgaaaaccatgtggctaag
ttgacgttcgccgagtgcaacgaatctacaacaggcacttacacctgccaagcaactaat
ggagccggtactgcgcaaacatcgtgcaaactcagcgtacaagacgtacctaaaattgaa
gtccatgaatcggagacttcgcaaatgattagagtgcgtaatcagtggaaggtcaaagct
acatacaagggttatccaaaaccaaccatttcttggcagaagaacagccaaccgttaccg
gtggctgataaacacataagcgtatatgacgacaacgacgaatggtcatcaacaatagct
atttactcggcggaaagacctgacaccggcgtctacacaataaccgcatcaaactcagcc
ggcacggccacgtgcaatttgaacctcaaagttattgataaaccaagcgcgccgcaaggc
ccgatgcgcatcaaagaaatcaactcagactctgtgacgatcgagtggaacaagccatcc
gatgacggtgggttggacatatcagcatatcaggttgaaagatgcaacgtgggcaagatg
atctggtccaaggtggctgacgtagaccacgacgtgtcagcttacagtgtgcaaaagtta
cacgaagacgccgagtatatgtttagggtttgcgctcaaaacgctgttggcgcatcagac
tttttggacagcgaacctgtcaccgtcaaatgtcgataccataaaccgtcagcaccacaa
ggtcctttgcagatcacgggtgtgacggatacgtcatcaacaatcgcttggttaccacct
ttggataatggtggaatagcgatcgaagactattgcgtagaaatcaaggaggtagacaaa
aaagcttggagaaagattggttccacgaaagacttacacataaagctattagacttgaaa
aaggggtcgtcctacgacatcaggattacggctaggaatcatgtgggctacggaaaacca
tatcaaccagacgaaccgattgtggcgggcaaacgcataaactttagaaatggaatatcc
gatgaaacactatacgtacttatgggaatattcccgaccagaccaaaagtttccgcttca
ccgtcgccgcccaccgaattcactgttagtgacattaccagcaaaagcgttaccttgcat
tggggcccaccagaaagtaatggtggatctgatatcacaggttatgtgattgaaaagcag
ctgaacacgacaaacaagtggttcaaagtagccacgctagaaccgaccgtaatgaaatat
tgcgtagaaaacttgaaagaaaaatcagaatatttcttcaagatctatgcggaaaattgt
atcggccttagtcaaccggtcgaaactaaattagtcagtctgttaacccatgccaccgta
ccctcgccgccaaccgctccgctggaagttcggaacctgagtaccaacgcagtgatcgtg
gaatggggcgtacctgaaacggacggcggtgctccgctattgggttacaacatagcaatt
cgggatgagaagaaaactatgtggatggaagtcggccgggtagaagcagacgtgcaaaag
ttcaacatcaaagacttgcaggagaaccataggtaccaaattaggatactggccaaaaac
gaagtgggtgtcagcgaaccactggaaactgaagaaccgtacaccgtacaaaaaccgaca
gagtattacgagtcggacgttgaagaatcggtaatggagtccaaaccgtctctgacgcaa
acatcagaaaccactacgtcatggctcagagacaacaacatggacgcagacatatcatct
tattcgaacgctgcgttattgaagaggagcgaatactttttccgcatttggtattacgcg
agaacgttattcaaataa

DBGET integrated database retrieval system