KEGG   Acyrthosiphon pisum (pea aphid): 100160582
Entry
100160582         CDS       T01076                                 
Name
(RefSeq) acylphosphatase, putative
  KO
K01512  acylphosphatase [EC:3.6.1.7]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api00620  Pyruvate metabolism
api01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:api00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    100160582
Enzymes [BR:api01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.7  acylphosphatase
     100160582
SSDB
Motif
Pfam: Acylphosphatase
Other DBs
NCBI-GeneID: 100160582
NCBI-ProteinID: NP_001155447
APHIDBASE: ACYPI001868
UniProt: C4WXP9
Position
A3:33913374..33919088
AA seq 102 aa
MAHLESGHSYVSVEFEVFGKVQGVYFTKYCRDRSTELDIVGWVKNSKRGTIMGKMQGQKA
NVEEMIAWLSNEGSPGSKIERCDLMNFEYLARKEFNGFSIRF
NT seq 309 nt   +upstreamnt  +downstreamnt
atggcacatctagagtcaggtcattcatacgtctcggtcgagtttgaagtattcggaaaa
gtacaaggagtgtactttaccaaatattgcagagatcgaagcactgaacttgatattgtc
ggatgggtaaaaaacagtaaaagaggtactataatgggcaaaatgcaaggacagaaagca
aatgttgaagaaatgatcgcatggttgtcaaacgaaggaagtcccggaagtaaaattgag
cgatgtgatctaatgaactttgaatatttggcaaggaaagaattcaatggatttagcata
agattttaa

DBGET integrated database retrieval system