KEGG   Acyrthosiphon pisum (pea aphid): 100160617Help
Entry
100160617         CDS       T01076                                 

Definition
(RefSeq) receptor-type guanylate cyclase Gyc76C isoform X1
  KO
K01769  guanylate cyclase, other [EC:4.6.1.2]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api00230  Purine metabolism
api01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:api00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100160617
Enzymes [BR:api01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     100160617
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase HNOBA ETRAMP
Motif
Other DBs
NCBI-GeneID: 100160617
NCBI-ProteinID: XP_001945615
APHIDBASE: ACYPI001901
UniProt: J9JNT2
Position
A2
AA seq 1356 aa AA seqDB search
MRNGRPKAAVLILLLALIVLKGPPGTPAQNTGSSSSTAAVTTTAVAYASPINVTNAPTTS
NATTTSVIETTTNVSAAASTILRNLTVGYLTAAKGKLDNRQGLAISGALTLALKEIEDDP
NLLPNVSLVLKWDDTHGETVHATKTISKMICDKVAVFFGPEGNTCYTEAIVAQAWNIPMI
SYKCADYKASEVPTFARTEPPDTQITKSIIALLRYYNWKKFSIITEEPWKNVAESLKIQA
QSANMSINHFMTIVDTHQCCEQDQSCCNVGHWYSVVQETMVNTRIYVFLGVAKSLVDMMN
TMHALQLFDNGDYMVIFVDTKINTWKDAQQYLWNQRDSYIDKPNCMEEKNFLQRARSLLV
IVASPPSPEKYEVFTSKVLDYTSKDPFKFKTPNVFTNVSYVKFVSIYAAYLYDSVMLYAR
ALDFLLRARANGGELTGEMIDEVAYNGTLIIETLVKNITYQSITGATIKLDKNGDSEGNY
SVVALKSHDFQYHLNEGNFSCPYYMIPVAQFYHGELLEYKLNSPNLKIEWPGKSRPDDEP
SCGFNNELCKKNDEEKSSIIVATVLALTLFCAFVITLSIYRKWKIELEIEGLLWKIDPSD
LLGYYNKDIVSSPSKLSLVSATSYESRCGLQVFATTGHYRNITVRIKELKFSKRKDISRE
QMKEMRLLRDLKHSNVNSFIGATIEPLRILIVTDYCAKGSLYDIVENEDIKLDKMFITSL
VHDLIRGMIFIHNSPLGCHGNLKSSNCIVTSRWVLQVTDFGLHDLRQGAENDSIGEHQYY
RNLLWKAPELLRDPSAWIKGSQKGDVYAFSIILHEIMCRRGPFGACGVEEPKEIIRLVKL
GYDEVNGVPLRPSIHHLRDCEMAEDYVIQCITDCWDEFPENRPDFGMIRARLKKMKDGKH
KNIMDQMMDMMEKYANNLEDLVNQRTHEVYEEKQKTEDLLHRMLPAPVAKQLTLGHGIEP
ESYNSVTIYFSDIVGFTAMSAESTPLQVVNFLNDLYTLFDKIIKGYDVYKVETIGDAYMV
VSGLPIRNGNRNSGEIASMSLNLLEAVKHHKIAHHPEATLKLRIGIHTGPVVAGVVGLTM
PRYCLFGDTVNTASRMESNGEPLKIHISEQCKNALDELGGYIIKERGYVNMKGKGDVLTY
WLEGTNEKAIKRRDVDLTESPPLFCGSKRHSPKMYNFGEFGSRRPSFAPRGNSFDQNARD
SQTILHEQRPTPLPHLLLEPRCRQMIHSASMDPFPNKHISRVSSMIKRSCRSLEDSKLLN
DQCTKEENCEESVEETVVNGSLQYTPLLSIEDNKRWHSFEDISMEPHRKKLVSRNSIKSW
LVGLFNGTATPCRTSEVSLRKTYSDRQQIVDKESVV
NT seq 4071 nt NT seq  +upstreamnt  +downstreamnt
atgcggaacggtcgaccgaaggcggcggtcctaatcttgttgctcgcgttgatcgtcctg
aaaggaccccccgggacgccggcgcagaacaccggcagctcatcgtctacagccgccgtc
accaccaccgccgtcgcctacgcctcacctatcaacgtcaccaacgccccgacaaccagc
aacgctaccacgacctcggtcatcgaaaccaccaccaacgtctccgccgccgccagtaca
atattgcggaacctgacggtcggctatctaaccgcagccaaggggaaactggacaaccgg
caaggcctggccatttcgggtgctctgactttggcgctgaaggagatcgaggatgatccg
aacctgttgcccaacgtgtcgttggtgttgaaatgggacgacacgcatggcgaaacggtg
cacgcgaccaaaaccatctcaaagatgatatgcgacaaagtggccgtgttttttggaccc
gagggcaatacgtgctacacagaggcgatagtcgcgcaggcgtggaacattccaatgatc
agctataaatgtgccgattacaaagcatcggaagttccgacgtttgctcgaacagaacct
ccagacactcagattaccaaatcgattatagccctgctaaggtattacaactggaagaag
ttcagcataatcacagaagaaccgtggaagaacgtagccgagtctttgaaaatccaagca
caaagcgccaacatgtccataaaccattttatgacaatagtcgatacgcaccagtgctgc
gaacaagaccagtcgtgctgcaacgtcggacactggtactcggtagtccaagaaaccatg
gtcaataccagaatttacgtatttttgggcgttgctaaatcactggtggacatgatgaac
acaatgcatgccttgcagctattcgacaacggcgattacatggtcatttttgtggacacc
aagatcaacacttggaaagacgcccaacaatatttgtggaatcaacgtgattcgtatatc
gacaaaccgaattgtatggaggagaaaaattttctccagcgtgcccgttcgttgttggtc
attgttgcctcgccaccgtcgccggaaaaatacgaagttttcacaagtaaagtgttagac
tacaccagcaaagatccgtttaaatttaagacaccgaacgtgtttacaaacgtgtcttat
gtcaagtttgtgtccatttacgctgcctatttgtacgattcggttatgttgtacgcacga
gctttagatttcttgctcagagccagagctaacggtggggaattaacaggtgaaatgatt
gatgaagtagcttacaacggaacactaataattgaaacacttgtcaaaaatataacctac
cagagtatcactggtgctactatcaaattagacaagaatggtgattcggaaggaaactat
tcggtggtagcgttaaagtctcatgattttcaataccatttaaatgaaggaaatttctct
tgcccgtattacatgattcctgtggctcaattctaccacggagaattactggagtacaaa
ttaaactctcctaatttgaaaattgaatggcctggtaagagtcgaccagatgatgaacct
agttgtggtttcaacaatgagttgtgcaaaaaaaatgacgaggaaaagagctctattata
gttgctacagttttggcactaacattattctgtgcgtttgtcatcaccctgtcgatatac
agaaaatggaaaatagaattagaaattgaaggactgttgtggaaaatagatccatcagat
ctgcttggatactataataaagatattgtttcatcccctagcaaactgagtctggtttcg
gctacctcatacgaatcccgttgtggacttcaagttttcgcaacaaccggccattatcgt
aatataacagtgagaattaaagaattaaagttttcaaagcgcaaagacatctctcgggaa
caaatgaaagaaatgagactattgagagatttaaaacatagcaacgtaaattcttttatc
ggtgctactatagaaccattacgaatacttatagtcaccgattattgtgctaaaggaagt
ctctatgatatagtagaaaacgaagacattaaattagacaaaatgtttattacatcttta
gttcacgatctcatcagaggtatgatatttatacacaactcgcctttaggttgtcatggg
aacttaaaatcatctaattgtattgtaactagtcgttgggtattgcaagtcactgatttt
ggtctacatgatttgaggcaaggcgcagaaaacgactctattggtgaacatcagtattat
agaaatttactatggaaagctccagagctattgagggaccctagtgcatggataaagggt
tcacaaaagggggatgtatacgcgttttctattatcttgcatgaaataatgtgtcgacga
ggtccttttggtgcttgcggcgtcgaagaacctaaagaaattataagactggttaagtta
ggttacgatgaagtaaatggtgtgccactgaggcctagtatacatcatttgagggactgt
gaaatggcagaagactatgttatccaatgcattactgattgttgggatgaattcccagaa
aataggccagactttggcatgatacgtgccagactcaaaaaaatgaaagatggaaaacat
aaaaatataatggatcaaatgatggacatgatggaaaaatatgcaaacaatctcgaagat
ctagtcaatcaacgtacgcatgaagtctatgaagaaaaacaaaaaactgaggatttattg
catcggatgctaccagcgccagtagcaaaacaattaactctgggacacggtatagaacca
gaatcatacaattcagttaccatttactttagcgatattgttggttttactgcaatgtct
gctgagagtactcctctgcaggttgtaaattttttaaacgatctatacacattatttgac
aaaatcattaaaggctacgatgtttacaaagtagaaacaataggagacgcatacatggtg
gtgtcagggttgcctattagaaatggtaatagaaattctggtgaaatagcttcgatgtca
ctaaatttgcttgaagctgtaaaacatcataaaatagctcatcatccagaagccacatta
aaattacgaataggaattcacacaggaccagtggtagctggtgtagttggtctcactatg
cctaggtattgtctgtttggcgatacagtaaatacagcctcacgaatggaatccaacggt
gaaccattaaaaattcacattagcgaacagtgtaaaaatgctcttgatgagttgggggga
tatataatcaaagaacgtggttatgttaacatgaaaggaaaaggagatgtgctcacttat
tggcttgaagggacaaatgaaaaagctattaaaagaagagatgtggacttgactgaatca
cctcctcttttttgtggatcaaaacgccacagtccaaaaatgtacaactttggagagttt
ggcagcagacgtccgtcatttgctcctcggggaaattcttttgatcaaaatgccagagac
agccagactatactccatgaacagcggccaactcctttacctcatcttctgcttgaacca
cggtgtagacaaatgatacattctgcgtccatggatccatttccaaacaaacacattagc
agagtaagctcaatgatcaaaagaagttgtcgttcattagaggattcaaaacttcttaat
gatcaatgtacaaaagaagaaaactgtgaagaaagtgttgaggaaactgtggttaatggt
agccttcaatatacccctttattgtcaatagaagacaataaacgatggcattcattcgaa
gacatttccatggaaccacatagaaaaaaattggtttcaagaaattcgattaaaagttgg
ttggttggattattcaatggcactgcaacaccttgtcgaacaagcgaagtgtcattacgc
aaaacatattcggacagacaacagattgttgacaaggagagtgtggtttaa

DBGET integrated database retrieval system