KEGG   Acyrthosiphon pisum (pea aphid): 100160824Help
Entry
100160824         CDS       T01076                                 

Definition
(RefSeq) putative inositol monophosphatase 3
  KO
K15759  inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api00562  Inositol phosphate metabolism
api00920  Sulfur metabolism
api01100  Metabolic pathways
api04070  Phosphatidylinositol signaling system
Module
api_M00131  Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100160824
  Energy metabolism
   00920 Sulfur metabolism
    100160824
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    100160824
Enzymes [BR:api01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     100160824
    3.1.3.25  inositol-phosphate phosphatase
     100160824
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Inositol_P Baculo_11_kDa GHL6
Motif
Other DBs
NCBI-GeneID: 100160824
NCBI-ProteinID: XP_008183289
APHIDBASE: ACYPI002095
UniProt: J9JPB2
Position
Un
AA seq 338 aa AA seqDB search
MIDIHINKLKLKKMIIRNKTLIKLFFLLIFCTIILYVSKYNFNNRYEFVRGKDLLEQAIQ
AAKLGGIQVEAIHNEHLINSQSKGRTVEGANDPVTNADYTSHCAMYYQLKKNIPNVKVIS
EEELSEKECKKLNIRKLKDYDNEHITNIEEEFERKYITIWIDPLDATQEFTESLTQYVTT
MVCVAYKGKPIMGVIHEPFSSKTTWAWLSRSRSNNFNNIKVPKKRSIIISRSHKGDVMGL
LNQRLYGLPVVTAGGAGFKVLQVLFGNSSAYIHTTNIKKWDICAGHAILKSIGGDMTSLE
NEDITYEKYTSMMHVGGILATARDHLYYINALKNGRSD
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgattgacattcatataaacaaattaaaactaaaaaaaatgattatccgaaataaaact
ctaattaaattattttttctcttgattttttgtacaattattctgtacgtgagcaagtat
aattttaataatagatatgaatttgtgagaggtaaagaccttttagaacaagcaatccaa
gcagctaaattgggtggaattcaagttgaagcgatccataacgaacatttgattaattcc
caatcaaaaggaagaactgtcgaaggtgcaaatgatccagtcactaacgctgattatact
tctcattgtgctatgtattatcagttgaaaaaaaatataccaaacgttaaagtgatatca
gaggaagaattatccgaaaaagaatgcaaaaagttaaatataagaaaattaaaagattac
gataatgaacatattacaaatattgaagaagaatttgagaggaaatatataaccatatgg
atagatccattagatgcaacacaagaattcactgaaagcttgacacaatatgtaacaact
atggtctgtgttgcttataaaggtaaacctattatgggtgttatacatgaaccgttttcg
tctaaaacaacatgggcttggttatcaagatcaagatcaaataatttcaacaatattaaa
gttcctaagaaaagatcaattattatttcaagatcacacaaaggtgatgtaatgggtcta
ttaaatcaacgattatatggtttaccagttgtaacagccggaggtgcaggattcaaagta
ttacaggttttgtttggaaattcgtcagcttatatacatacaactaacataaaaaaatgg
gatatatgtgctggacatgctatactcaaaagtataggaggtgatatgacatcgttggaa
aatgaagatataacatatgaaaagtatacaagtatgatgcatgttggaggaatattagct
actgcacgtgatcatttgtactatataaatgctctaaaaaatggaagaagtgattaa

DBGET integrated database retrieval system