KEGG   Acyrthosiphon pisum (pea aphid): 100161173Help
Entry
100161173         CDS       T01076                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha-like
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api04140  Autophagy - animal
api04213  Longevity regulating pathway - multiple species
api04310  Wnt signaling pathway
api04341  Hedgehog signaling pathway - fly
Module
api_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:api00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100161173
   04341 Hedgehog signaling pathway - fly
    100161173
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100161173
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    100161173
Enzymes [BR:api01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100161173
Protein kinases [BR:api01001]
 Serine/threonine kinases: AGC group
  PKA family
   100161173
Messenger RNA biogenesis [BR:api03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100161173
Chromosome and associated proteins [BR:api03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100161173
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo Haspin_kinase EMA APH
Motif
Other DBs
NCBI-GeneID: 100161173
NCBI-ProteinID: XP_001948356
APHIDBASE: ACYPI002416
UniProt: J9JQ66
Position
Un
AA seq 361 aa AA seqDB search
MGNLSFRQKKGRNDLSISKTSSCGLTEFWNQKRQDFDDIYFNNKNFPPADAADFRVTTIL
DEGSFGSVVLTTHKRTGTVHATKVIAKKKIVKGRNVQRMLNEKRILESINFPFVISLEYF
YQDNSFIYFVMPFVCGGNIHTHMKRHGPMDEDKARFYFSEVLLAVEYLHKLNLVHRDIKP
ENVLIDVNGHAQLADFGFCKHIKGRTFTFCGTAEYLAPEIILRRGYGKAVDYWSLGVLLY
EMLANRSPFIDRDTGKLFSNIVTGSYSCPLGFSDDVINLLRNILKVDVTRRYGNLANGIR
DIKKHRWFGDQDWCAAFDRRVTPPYVPVISDTLDTRNFDPQHGHLFYDASKDMFGDIFKD
F
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgggtaatttatcatttagacaaaagaagggcaggaatgatttgtcgatcagtaaaaca
tcgtcatgtggccttaccgaattctggaaccaaaaaagacaagattttgatgatatctac
tttaataataagaattttccaccagctgatgctgcggactttcgtgtgacaaccatattg
gatgaaggatctttcggttctgttgtattgacaactcacaaaagaactggtactgttcat
gcaacaaaagtaattgccaaaaagaaaatcgtgaaaggtcgtaatgtgcaacgaatgctt
aatgagaaacgaattttggaatccatcaattttccgtttgtcattagcctcgagtatttc
taccaagacaacagtttcatttactttgtcatgccgttcgtgtgcggcggtaacattcat
actcacatgaaacgccacggaccgatggacgaggacaaagcgcggttttatttttcagaa
gttcttctggccgtcgaatacctacacaagttaaacttggtgcatcgagatatcaagccc
gaaaatgtactaatcgacgtcaacgggcatgctcaactcgcagactttgggttttgtaaa
cacattaagggtcgtacgttcacgttttgtggcactgccgaatacttggcgccagaaatt
atactcagacgaggatacggaaaagcggtcgactattggtcgctcggcgtactcctgtac
gagatgttggctaaccgttcgccgttcatcgatcgcgacaccggcaagctgttcagtaac
atcgtgaccgggtcgtacagctgcccgttgggcttctcggacgacgtgatcaacctgttg
cggaatatcctcaaggtggacgtgaccaggcggtacgggaacttggcgaacggcatccgg
gacatcaagaagcacaggtggttcggtgaccaggactggtgcgcggcgttcgacaggcgc
gtgacgccgccgtacgtgccggtcatcagcgacaccctcgacaccagaaacttcgatccg
caacacggccatctgttctacgacgccagcaaggacatgttcggcgacattttcaaggac
ttttga

DBGET integrated database retrieval system