KEGG   Acyrthosiphon pisum (pea aphid): 100161259Help
Entry
100161259         CDS       T01076                                 

Definition
(RefSeq) acetyl-CoA acetyltransferase, cytosolic isoform X1
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api00071  Fatty acid degradation
api00072  Synthesis and degradation of ketone bodies
api00280  Valine, leucine and isoleucine degradation
api00310  Lysine degradation
api00380  Tryptophan metabolism
api00620  Pyruvate metabolism
api00630  Glyoxylate and dicarboxylate metabolism
api00640  Propanoate metabolism
api00650  Butanoate metabolism
api00900  Terpenoid backbone biosynthesis
api01100  Metabolic pathways
api01200  Carbon metabolism
api01212  Fatty acid metabolism
Module
api_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:api00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    100161259
   00630 Glyoxylate and dicarboxylate metabolism
    100161259
   00640 Propanoate metabolism
    100161259
   00650 Butanoate metabolism
    100161259
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100161259
   00072 Synthesis and degradation of ketone bodies
    100161259
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100161259
   00310 Lysine degradation
    100161259
   00380 Tryptophan metabolism
    100161259
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    100161259
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:api04147]
    100161259
Enzymes [BR:api01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     100161259
Exosome [BR:api04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100161259
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C DUF935
Motif
Other DBs
NCBI-GeneID: 100161259
NCBI-ProteinID: XP_001951861
APHIDBASE: ACYPI002494
UniProt: X1WII2
Position
A1
AA seq 393 aa AA seqDB search
MADEVYIVSAVRTPIGSFGGSLSSLKAHQLGSIVISEALKRANVNSNEVSEVILGQTLTA
GQGQNPARQASINAGIPITVPAHGINLLCGSGLKSVVHGYQSIKCGDSSIVIAGGQESMS
NAPHVVNIRSGVKMGNTELIDTMLYDGLTDAFNNIHMGITAENIAEQYNISRELQDNYAF
ESQKRTAEAQKNGYFKDEITPVEVKIRQNTIVFDTDEYPRNDTTLNSLSALRPAFKPNGG
VVTVGNASGRNDGAAVVLLMNGEECKKRGCTPMAKIVAHAVCGLDPKIMGMGPVPAVFKT
IEKAGWTMDSVDIFELNEAYAAHSIAVERDLGISSEKVNINGGAISLGHPIGASGARVLV
TLVHILLRTGKKRGIASLCIGGGMGIAIAVETL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgaagtatatattgtatctgccgtccgtacaccaataggttcatttggcggt
tcattgtcgtctttgaaagctcaccaattaggctccatagtgatttcagaagcacttaaa
agagctaatgtcaattcaaatgaagtgtctgaagttattcttggacagacccttacagct
ggacaaggtcaaaatccagcaagacaagcttcgataaatgctggaattccaatcactgta
cctgctcatggtattaacctactctgtggatctgggctgaagtctgtggttcatggatac
cagtcaatcaaatgcggagattcttcaattgtcattgcaggtggccaagagagcatgagt
aacgctcctcatgttgtcaatatacgatctggtgtcaaaatgggtaacacagaattgata
gatacgatgctatacgatggtttgacagacgcatttaacaacatacacatgggcataact
gctgaaaatattgctgaacagtataatatttcaagggaacttcaagacaattatgctttt
gagtctcagaaacggacagcagaagctcaaaaaaatggttacttcaaagatgaaataaca
cctgttgaggtgaaaatacgacagaataccatcgtatttgacacagatgaatatccaaga
aatgatacaactttaaattcattatccgcattgagaccagcttttaaacctaatggtggt
gtagtcactgtcggaaatgcatcaggaagaaatgatggtgctgcagtagtccttttaatg
aacggagaagaatgtaaaaaacgaggttgtactccaatggctaaaatcgttgctcatgct
gtgtgcgggcttgatccaaaaataatgggtatgggaccagtacctgctgtgtttaagacg
attgaaaaagctggttggacaatggatagcgtggatatttttgaattaaatgaagcatat
gctgcacattcaattgctgtagagcgtgatttaggaatatcttcagagaaagtaaacatt
aatggaggtgccatttcattgggtcatcctatcggagcatctggtgctcgagtattggtt
acgttggtgcacatattgttaaggaccggcaaaaaacgaggaatagcatccttgtgtatt
ggcggaggtatgggtattgctattgctgtcgaaacattataa

DBGET integrated database retrieval system