KEGG   Acyrthosiphon pisum (pea aphid): 100161452
Entry
100161452         CDS       T01076                                 
Name
(RefSeq) fatty acyl-CoA reductase wat
  KO
K13356  alcohol-forming fatty acyl-CoA reductase [EC:1.2.1.84]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:api00001]
 09100 Metabolism
  09103 Lipid metabolism
   00073 Cutin, suberine and wax biosynthesis
    100161452
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100161452
Enzymes [BR:api01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.84  alcohol-forming fatty acyl-CoA reductase
     100161452
SSDB
Motif
Pfam: NAD_binding_4 Sterile Polysacc_synt_2 Epimerase GDP_Man_Dehyd
Other DBs
NCBI-GeneID: 100161452
NCBI-ProteinID: XP_003248040
APHIDBASE: ACYPI002672
UniProt: A0A8R2D6R2
Position
A1:complement(7941690..7949910)
AA seq 522 aa
MDIYNANCESTTQLSEIQSFYNDTTIFLTGGTGFMGNLILDKLIRTCSGVQRIYILIREK
KGKTTEERFKELFDDPVFELMKKEQPNFLEKITAVIGDCALPNMGIEEKYINIIKDEVNI
VIHSAATVRFDEHLRIAVNINIIALQDILKISQNIKNLKAFVHISTAYSNCAGREVVDEI
FYKPPITGDKLLQVVNGLDDEYVTRITPSLLGEWPNTYAMTKAIAEGEIMTYGKGLPIGV
IRPSMIIATDNEPVPGWINNFYGPTGVVAATGIGLMRCMNADSTKTADIVPGDYVSNAVL
ACAWDIHNQWKERNASNEMKVDNLEKETLIDPPIYNFVSSRANPLTWGEFSALNKKYGRE
VPPLKAISPILLRLSKNKHEYQILCFILHIIPAFIIDSLAKLTGKKPLLMEGYRKMHKFS
KVISYFSLKSWTFNDDNTRSLVQKLSKLDQTLFRFDLTKLSWNEYFKKHVIGIRMYIIKD
PMETLSEGRKWNQKLCIAYYTLLSILAATFLLILYGIFNLFI
NT seq 1569 nt   +upstreamnt  +downstreamnt
atggacatctacaatgcaaactgcgaaagtacaactcaactatcagaaattcaatcattt
tacaatgatacgacaatatttttaactggtggtactggattcatgggaaatttaatactg
gataaattgataaggacttgttcgggagtgcaaagaatttatattttaatcagagagaaa
aaaggaaaaacaacagaagaaagatttaaagaactctttgatgaccctgtatttgaatta
atgaaaaaagaacaaccaaactttttagaaaagatcactgcagttatcggtgattgtgct
ttaccaaacatgggaatcgaagaaaaatatataaacattattaaagacgaagtaaacatt
gtaatacactccgctgctactgtacgatttgacgaacatttaagaatagctgtcaatatt
aacataattgccttacaagatatattaaaaattagccaaaacattaaaaacttgaaagct
ttcgttcacatttcaactgcttattctaactgtgctggaagggaagttgtggatgagata
ttctacaaaccacctataactggagacaagttattgcaggtcgttaacggtcttgacgac
gaatacgtcactagaattacaccttcgttactaggagaatggccaaatacctacgcgatg
acaaaagctattgccgagggcgaaataatgacttatggcaaagggttgccaattggagtt
attagaccgtcaatgattatcgccactgataatgaacctgttcctggatggatcaacaat
ttctatgggccgacaggagttgtagcagccaccggcattggtctcatgaggtgtatgaat
gccgattcaactaaaacagccgatatcgtgcctggagattatgtcagcaatgccgtgttg
gcttgtgcttgggatattcacaaccaatggaaagaacgtaacgcctctaacgaaatgaaa
gttgataacttagaaaaagaaacattaattgatccacctatttacaatttcgtatcatca
agagccaatccattgacatggggagaattttcggcgttgaacaaaaaatacggtcgcgaa
gtgcctcctttaaaagcgatttcaccaattctattaagattatccaaaaacaaacacgaa
taccaaattttatgttttattctccacataataccagcatttataattgattcattagcc
aaactcaccggaaagaagcctctattaatggaaggatatagaaaaatgcacaaattctcc
aaagttatatcttacttcagtttaaaatcgtggacatttaacgatgataatacaaggtct
ttggtacaaaaattatccaaattagatcagactcttttcagattcgatttaaccaaattg
agctggaatgaatatttcaaaaaacacgtaataggtattcgaatgtatattataaaagat
ccaatggaaacattatcagaaggaagaaaatggaatcaaaaattatgcattgcttactac
acattattatccattttagctgccacatttttattaatactgtatggaatttttaatttg
tttatataa

DBGET integrated database retrieval system