KEGG   Acyrthosiphon pisum (pea aphid): 100162113
Entry
100162113         CDS       T01076                                 

Definition
(RefSeq) separin
  KO
K02365  separase [EC:3.4.22.49]
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
KEGG Orthology (KO) [BR:api00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:api01002]
    100162113
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:api03036]
    100162113
Enzymes [BR:api01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     100162113
Peptidases and inhibitors [BR:api01002]
 Cysteine peptidases
  Family C50: separase family
   100162113
Chromosome and associated proteins [BR:api03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Separase
    100162113
SSDB
Motif
Pfam: Peptidase_C50 CHAT DUF4317 SRP_TPR_like DUF5713
Other DBs
NCBI-GeneID: 100162113
NCBI-ProteinID: XP_029347076
APHIDBASE: ACYPI003288
Position
A3
AA seq 563 aa
MDPDAVCRTVLNEIEECLSQIKQMPLPPFPVYENTNKAAAYISYRLKEYDSVAYYLSEAH
GGGIRSKLSLIMNPDTASKKELNDCLSLNSEYVTKRYNGLVERLKEMPSEWTIIQITKNY
NPKDVVTPRPTDKPTDVSELFISRYQCGQKHKNIKPLTVKVDKPKTSLGQKTIFEVLKKS
LEDTNDRQNKDPSAIRNLRDSASQSIKNISQEIHTSWIKHWICMLLGNYIDEKLSAEVYS
VIDNVIEEENMTISDRGRMILYQITNAVVQLTNDEINNILKEVDCSTEEINKFESAINKY
KSNGSHLMLKKRHSVLLILDEHLECLPWETIPCLRRHPVSRVSSVHIVHRLYHKHKDSIQ
NGLMKIKNQGYYILNPDKSLSNAEKRMESFLKERNVNWDGIQSQEPTSEQFSSLLKKNNI
LLYCGHGNGTQYLHSLDLDKLDLQCIPMLFGCSSAKHTDKGGRSNFVGASYGYLKAGCPC
VIGMLWNVTSLDADNSARAMLNVWLPGNPINLQEKWPKKFLDQQDYPMERELLRSLAIAR
KTTRSFFNYAALVARGIPVIMTD
NT seq 1692 nt   +upstreamnt  +downstreamnt
atggatccggatgcagtgtgccggaccgtcctcaatgagatcgaagagtgtttgtcgcaa
attaaacaaatgcctttgccaccatttcctgtttacgagaatacaaataaagctgccgct
tatatcagctatcgtttaaaagagtatgattctgttgcttattatctttctgaagctcat
ggaggcggaattcgttcaaaactatcattgataatgaatccagatactgcaagtaaaaaa
gaactcaacgattgtttatccttgaactcagaatatgtgactaaaagatacaatggtctt
gttgaacgtttaaaggaaatgccatctgaatggacaataatacaaattactaaaaactat
aatcctaaagatgtagtaactcctaggcctacagataaacctacagatgtttctgaacta
tttatatctagatatcagtgtggtcaaaaacacaagaatattaaacctttgactgtaaaa
gtggataagcccaaaaccagtttaggacaaaagactatctttgaagttctgaaaaaaagc
ttagaagacacaaatgacagacaaaataaggatccatctgctattcggaatttaagggat
tcagcttcccagtcaattaaaaacatatcacaggaaattcatactagttggataaaacat
tggatttgtatgttattaggcaattatattgatgagaaactttcagcagaagtctatagt
gttattgataatgtcatagaagaagaaaatatgactataagtgaccgaggcagaatgatt
ttgtatcagataacaaatgcagttgttcaattgactaatgatgaaataaacaacattctt
aaagaagtcgactgttcaacagaggaaataaataaatttgaatctgctattaataaatat
aaatcaaatggttcacatttaatgttgaaaaagagacattctgttttgctcatactagat
gagcatttagaatgcttgccatgggaaacaataccatgtttgagaagacatccagtctcc
cgtgtgtcatctgtacatattgtgcatagattatatcacaaacacaaggattctattcaa
aacggattaatgaaaattaagaatcaaggatactacattttaaaccccgataaatcattg
tctaatgcagaaaaaagaatggagagtttcctcaaagaaagaaatgtgaactgggacggc
attcaaagtcaggagcctacttcagaacagttcagttcattacttaaaaaaaataacata
ctattatattgtggccacggtaatggaacacaatacttgcatagtttagatttagacaaa
ttagatctacaatgtataccaatgttgtttggttgttcaagtgccaaacacactgacaaa
ggaggaaggtctaattttgtgggtgcttcttatggatatttaaaagctggctgtccctgt
gtcattggtatgttgtggaatgtaacaagtttagatgctgacaactcggccagagccatg
cttaatgtatggcttcctggaaatcccatcaaccttcaagagaaatggcctaaaaaattt
ttagatcaacaggattaccccatggaacgagaactcttgcgttcattagcaattgccagg
aaaactacaagaagttttttcaactatgctgctttagtcgcccgaggcataccggttatc
atgacggactga

DBGET integrated database retrieval system