KEGG   Acyrthosiphon pisum (pea aphid): 100162212Help
Entry
100162212         CDS       T01076                                 

Definition
(RefSeq) methionine--tRNA ligase, mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api00450  Selenocompound metabolism
api00970  Aminoacyl-tRNA biosynthesis
api01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:api00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    100162212
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    100162212
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:api01007]
    100162212
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:api03016]
    100162212
Enzymes [BR:api01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     100162212
Amino acid related enzymes [BR:api01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   100162212
Transfer RNA biogenesis [BR:api03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    100162212
 Prokaryotic type
   Other AARSs
    100162212
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1 tRNA-synt_1e Alpha-amylase_N
Motif
Other DBs
NCBI-GeneID: 100162212
NCBI-ProteinID: XP_001949836
APHIDBASE: ACYPI003377
UniProt: J9JSS7
Position
A2
AA seq 527 aa AA seqDB search
MSRISTSFKDVTKKTSYFITTPIFYVNASPHIGHLYSALIADASARFQKLLNPSLNIIFS
TGTDEHGLKVQKAAENCKISVKNYCTKISSSYQTTFDKFDISHTSFIRTTAENHKNCVHY
FWSKLQPHIRKGKYSGWYCTADETFLSQDQIELVNNVRVSKESGRQVEWAEEDNYKFDLR
PFKHDLQCWLSKPDRIKPKVFHEILNREVNDLYDISLSRPKSRVSWGIPVPRDDTQTVYV
WLDALVNYLTVSGYPDSKIWPPNVQVCGKDILKFHGILWPIFLIAAGLELPKQIFVHSHW
KVNDEKMSKTKGNVVDPINAGCQYTESGLRYFLLREGTAHSDGNYSDLKIKRILNAELAD
TLGNLLNRCCGKAINPNLSYPKLDLLQIERLLADSYFIELSKKLEVLADIVGSHYEELNF
YKGIDEIIATLQCCNRFFEYNKPWELAKQDVNKLKCILHITMETLRISGLALQPIVPVLA
DQLLNKLNINNRDWNQMTPTWKDENRIVNPTNLKKDNIVLFKKLLIN
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgaataagtacaagtttcaaagatgtaactaaaaagacttcatactttattaca
acaccaatattttacgtaaatgcaagtccacacattgggcatctatacagtgctttaatt
gctgatgcttctgcaagatttcaaaaattacttaacccaagtttaaatattatttttagt
actggtactgatgaacatggattaaaggtacaaaaagctgctgaaaattgtaaaatatcc
gtgaaaaattattgtacaaaaatttcaagtagttatcaaactacatttgataaatttgat
attagtcatacatctttcatacgaacaacagcggaaaaccacaaaaactgtgtacattat
ttttggagtaaattacaaccacatattagaaaaggaaagtattctggttggtattgtaca
gctgatgaaacttttttgtcacaagatcaaatcgaattagttaataatgtacgtgttagt
aaagaatcagggagacaagttgagtgggctgaagaagacaattacaaatttgacctacga
cctttcaaacatgatcttcaatgttggttgagtaaaccagacagaattaaaccgaaggtg
ttccatgaaatactgaatagagaggtaaatgatttatatgatatatcattgtcaagacca
aaaagtcgggtcagttggggtattccagtaccaagagatgatacacagactgtatatgta
tggttagatgcacttgttaattatttaactgtttctggatatccagacagcaaaatttgg
cctccaaatgtccaagtatgcggtaaagatattttgaaattccatggaatattatggcct
atattcttaatagctgcaggtttagaactcccaaaacaaatttttgtacattctcattgg
aaagttaacgatgaaaaaatgtctaaaaccaaaggaaatgtagtagatccaataaatgct
ggttgccagtatactgaatctggtttaagatattttttgcttagagaaggtacagctcac
agtgatggtaactacagtgatctgaaaattaaaagaatattaaatgctgaattagcagac
acgttgggtaacctattgaaccgttgctgtggaaaagccattaacccaaatcttagttac
ccaaaattagatttattacagattgaaaggttattggctgattcatatttcattgaatta
agtaaaaaattagaggttcttgcagatatagttggaagtcattatgaagaattaaatttt
tacaaaggtatagatgaaataatagccacattacagtgttgcaatcgattttttgagtac
aataaaccttgggaattagctaaacaagatgtcaataaattgaaatgtatactacatata
actatggagactttgagaatttctgggttagctttacagccaattgtacctgtactagct
gatcaactattaaataagttaaacataaataatagagattggaatcaaatgacgccaacg
tggaaagatgaaaacagaatcgttaatccaacaaacttgaaaaaagataatattgtatta
tttaaaaagttgttgataaactaa

DBGET integrated database retrieval system